Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X0S8I4

Protein Details
Accession A0A1X0S8I4    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
10-36ESWHNQLKPNYLQRKRKRRLDRLIFILHydrophilic
NLS Segment(s)
PositionSequence
25-26RK
Subcellular Location(s) nucl 16.5, cyto_nucl 12.5, cyto 5.5, pero 2
Family & Domain DBs
Amino Acid Sequences TNMETNNYIESWHNQLKPNYLQRKRKRRLDRLIFILVDDVHADFMHNTARMAANIGRMSSETREARKRMIAAEEIN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.37
3 0.42
4 0.48
5 0.55
6 0.58
7 0.61
8 0.68
9 0.73
10 0.82
11 0.85
12 0.87
13 0.88
14 0.88
15 0.89
16 0.89
17 0.85
18 0.8
19 0.75
20 0.64
21 0.53
22 0.43
23 0.32
24 0.22
25 0.15
26 0.09
27 0.05
28 0.05
29 0.05
30 0.04
31 0.05
32 0.06
33 0.06
34 0.06
35 0.07
36 0.08
37 0.08
38 0.11
39 0.11
40 0.14
41 0.14
42 0.15
43 0.14
44 0.14
45 0.16
46 0.16
47 0.22
48 0.22
49 0.28
50 0.36
51 0.38
52 0.41
53 0.44
54 0.44
55 0.41
56 0.41