Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X0S4I5

Protein Details
Accession A0A1X0S4I5    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
14-41WEFKANNVENKKRKKEKFNNGEKRKKLSHydrophilic
NLS Segment(s)
PositionSequence
24-50KKRKKEKFNNGEKRKKLSNADYKKKKK
Subcellular Location(s) nucl 24, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR027417  P-loop_NTPase  
Amino Acid Sequences MKRVIHFEDQEPEWEFKANNVENKKRKKEKFNNGEKRKKLSNADYKKKKKEMLDFRKQLPIYSGREAIINALKENSTVIVMGETGSGKTTRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.24
3 0.2
4 0.28
5 0.27
6 0.31
7 0.38
8 0.47
9 0.54
10 0.64
11 0.72
12 0.74
13 0.78
14 0.82
15 0.84
16 0.86
17 0.88
18 0.89
19 0.9
20 0.9
21 0.92
22 0.85
23 0.8
24 0.73
25 0.68
26 0.62
27 0.6
28 0.6
29 0.61
30 0.67
31 0.72
32 0.76
33 0.78
34 0.77
35 0.72
36 0.67
37 0.67
38 0.68
39 0.68
40 0.7
41 0.68
42 0.65
43 0.68
44 0.62
45 0.52
46 0.44
47 0.4
48 0.34
49 0.32
50 0.31
51 0.24
52 0.25
53 0.24
54 0.23
55 0.22
56 0.18
57 0.15
58 0.15
59 0.14
60 0.14
61 0.14
62 0.12
63 0.08
64 0.08
65 0.07
66 0.07
67 0.07
68 0.07
69 0.07
70 0.07
71 0.07
72 0.09