Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X0RL70

Protein Details
Accession A0A1X0RL70    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
35-62GLPPVGVKYNKKKRKKKKLMANSEEKGEBasic
NLS Segment(s)
PositionSequence
33-52KRGLPPVGVKYNKKKRKKKK
Subcellular Location(s) nucl 14, mito_nucl 12.833, mito 10.5, cyto_nucl 8.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR025476  Helitron_helicase-like  
Pfam View protein in Pfam  
PF14214  Helitron_like_N  
Amino Acid Sequences MFNLKVRHLLKDLKKKNIFGRYKRFVRTIEYQKRGLPPVGVKYNKKKRKKKKLMANSEEKGEPSCQK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.69
3 0.72
4 0.74
5 0.73
6 0.71
7 0.74
8 0.72
9 0.73
10 0.72
11 0.67
12 0.58
13 0.54
14 0.54
15 0.55
16 0.56
17 0.53
18 0.51
19 0.5
20 0.51
21 0.47
22 0.38
23 0.29
24 0.22
25 0.25
26 0.31
27 0.34
28 0.37
29 0.46
30 0.56
31 0.64
32 0.72
33 0.76
34 0.8
35 0.86
36 0.92
37 0.92
38 0.93
39 0.94
40 0.95
41 0.93
42 0.92
43 0.84
44 0.77
45 0.68
46 0.58
47 0.49