Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J0DDW3

Protein Details
Accession J0DDW3   
Localization Confidence High
Confidence Score 16.2
NoLS Segment(s)
PositionSequenceProtein Nature
7-26SAECRKRHARLAMRRSEHKTBasic
162-197DYLPHGRDKKSRRDTLKRHRNKGCPKVPKGRERKTSBasic
NLS Segment(s)
PositionSequence
168-197RDKKSRRDTLKRHRNKGCPKVPKGRERKTS
Subcellular Location(s) nucl 23, cyto_nucl 14
Family & Domain DBs
KEGG adl:AURDEDRAFT_166415  -  
Amino Acid Sequences MQLHVDSAECRKRHARLAMRRSEHKTADPGYPSENDAGTARYGSYILNGKHFPGPSLCFFGMTGATPTQHEDRDVPILSEHRPGTHPSHRAATDHTPATGPVASPSPFDEPDGRNPCGSDDEYLPSESDESDDYLAHGNDDEYLPSESDESDDYLAPESDDDYLPHGRDKKSRRDTLKRHRNKGCPKVPKGRERKTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.58
3 0.61
4 0.71
5 0.76
6 0.77
7 0.81
8 0.79
9 0.77
10 0.7
11 0.63
12 0.59
13 0.52
14 0.51
15 0.45
16 0.4
17 0.36
18 0.33
19 0.31
20 0.26
21 0.23
22 0.18
23 0.16
24 0.16
25 0.13
26 0.12
27 0.1
28 0.09
29 0.09
30 0.08
31 0.11
32 0.15
33 0.15
34 0.2
35 0.2
36 0.22
37 0.25
38 0.25
39 0.24
40 0.21
41 0.24
42 0.21
43 0.27
44 0.25
45 0.21
46 0.21
47 0.2
48 0.17
49 0.15
50 0.14
51 0.09
52 0.1
53 0.09
54 0.12
55 0.13
56 0.13
57 0.14
58 0.13
59 0.14
60 0.18
61 0.17
62 0.15
63 0.14
64 0.16
65 0.15
66 0.19
67 0.17
68 0.15
69 0.16
70 0.19
71 0.24
72 0.28
73 0.3
74 0.28
75 0.32
76 0.31
77 0.31
78 0.31
79 0.29
80 0.26
81 0.24
82 0.22
83 0.18
84 0.17
85 0.18
86 0.14
87 0.1
88 0.07
89 0.08
90 0.08
91 0.09
92 0.11
93 0.12
94 0.12
95 0.13
96 0.16
97 0.16
98 0.25
99 0.3
100 0.29
101 0.27
102 0.27
103 0.27
104 0.26
105 0.25
106 0.17
107 0.13
108 0.15
109 0.16
110 0.17
111 0.16
112 0.13
113 0.12
114 0.1
115 0.1
116 0.08
117 0.07
118 0.07
119 0.07
120 0.08
121 0.09
122 0.09
123 0.09
124 0.08
125 0.07
126 0.07
127 0.08
128 0.08
129 0.07
130 0.09
131 0.09
132 0.09
133 0.09
134 0.08
135 0.09
136 0.09
137 0.08
138 0.08
139 0.08
140 0.09
141 0.1
142 0.1
143 0.09
144 0.09
145 0.08
146 0.09
147 0.09
148 0.09
149 0.11
150 0.14
151 0.15
152 0.2
153 0.25
154 0.27
155 0.35
156 0.42
157 0.5
158 0.57
159 0.66
160 0.71
161 0.77
162 0.84
163 0.87
164 0.91
165 0.91
166 0.91
167 0.91
168 0.91
169 0.91
170 0.91
171 0.9
172 0.9
173 0.88
174 0.89
175 0.89
176 0.89
177 0.89