Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X0S3Q1

Protein Details
Accession A0A1X0S3Q1    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MNPVGRVRRPRIRKRDPNHIPRPMNSHydrophilic
NLS Segment(s)
PositionSequence
7-15VRRPRIRKR
92-95KKRK
Subcellular Location(s) nucl 19, mito_nucl 13.166, cyto_nucl 12.166, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01389  HMG-box_ROX1-like  
Amino Acid Sequences MNPVGRVRRPRIRKRDPNHIPRPMNSFLSYRTEMQAVIRKHCPLANHREISKVVAKWWHEASDEEKQVFRNKAEIAKDEHTKMYPDYKFNPKKRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.89
3 0.89
4 0.9
5 0.89
6 0.88
7 0.8
8 0.73
9 0.72
10 0.64
11 0.57
12 0.48
13 0.4
14 0.32
15 0.34
16 0.33
17 0.28
18 0.25
19 0.22
20 0.2
21 0.22
22 0.26
23 0.21
24 0.23
25 0.24
26 0.24
27 0.25
28 0.26
29 0.26
30 0.24
31 0.32
32 0.35
33 0.35
34 0.35
35 0.37
36 0.36
37 0.36
38 0.35
39 0.26
40 0.2
41 0.22
42 0.23
43 0.23
44 0.24
45 0.23
46 0.19
47 0.2
48 0.23
49 0.26
50 0.28
51 0.25
52 0.25
53 0.26
54 0.31
55 0.32
56 0.28
57 0.24
58 0.24
59 0.29
60 0.32
61 0.33
62 0.33
63 0.36
64 0.4
65 0.38
66 0.38
67 0.34
68 0.33
69 0.32
70 0.35
71 0.33
72 0.34
73 0.39
74 0.47
75 0.57