Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J0CW83

Protein Details
Accession J0CW83    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
284-313RLGRRMRQNLGKWVRRRRKAITDKAQKATTHydrophilic
NLS Segment(s)
PositionSequence
267-303KLRARRRRLVLLDRQLQRLGRRMRQNLGKWVRRRRKA
Subcellular Location(s) mito 11, nucl 6.5, cyto_nucl 6, cyto 4.5, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR040521  KDZ  
KEGG adl:AURDEDRAFT_75877  -  
Pfam View protein in Pfam  
PF18758  KDZ  
Amino Acid Sequences MSPTAAAASSIPFSRAEESAAAANNTGSTRCSEYLVSCCGMCFNDTQYGRSVEEGCDIHVGGDANFSQRHNFVAGDSPPFQYRGVYQLSPDRVAAMEARLNAAGKRPSGRYKGGVPDEDLDACADSHTAGSSAKEKVKGDRFDDKGVFALICRHGIPLCFMNITDAGEGQKYMLAAVEWLSEQLPNRATVAAYYDVGCITDRTRQLYDVLPAGFGDRLVFVTSAMHSYAHQWTCQIVYSPRMKKGMGLTDGEGVERLWSALRMLIPKLRARRRRLVLLDRQLQRLGRRMRQNLGKWVRRRRKAITDKAQKATTQLVKSGHARRYLRSQWEEQRQAELSIR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.17
4 0.16
5 0.17
6 0.19
7 0.21
8 0.19
9 0.16
10 0.16
11 0.15
12 0.15
13 0.14
14 0.12
15 0.12
16 0.17
17 0.18
18 0.2
19 0.2
20 0.22
21 0.25
22 0.28
23 0.26
24 0.21
25 0.2
26 0.2
27 0.19
28 0.17
29 0.14
30 0.14
31 0.22
32 0.23
33 0.24
34 0.26
35 0.29
36 0.28
37 0.29
38 0.27
39 0.19
40 0.23
41 0.22
42 0.19
43 0.18
44 0.17
45 0.15
46 0.15
47 0.15
48 0.1
49 0.11
50 0.11
51 0.12
52 0.14
53 0.14
54 0.14
55 0.14
56 0.16
57 0.15
58 0.15
59 0.13
60 0.18
61 0.19
62 0.22
63 0.23
64 0.24
65 0.23
66 0.24
67 0.23
68 0.18
69 0.17
70 0.17
71 0.2
72 0.18
73 0.19
74 0.25
75 0.27
76 0.28
77 0.26
78 0.23
79 0.18
80 0.19
81 0.17
82 0.13
83 0.12
84 0.11
85 0.12
86 0.12
87 0.12
88 0.12
89 0.16
90 0.16
91 0.16
92 0.19
93 0.22
94 0.28
95 0.33
96 0.36
97 0.34
98 0.36
99 0.43
100 0.44
101 0.41
102 0.36
103 0.33
104 0.31
105 0.28
106 0.23
107 0.15
108 0.11
109 0.1
110 0.08
111 0.06
112 0.05
113 0.05
114 0.05
115 0.05
116 0.05
117 0.06
118 0.09
119 0.12
120 0.15
121 0.18
122 0.19
123 0.26
124 0.33
125 0.36
126 0.38
127 0.43
128 0.44
129 0.44
130 0.44
131 0.38
132 0.3
133 0.27
134 0.22
135 0.13
136 0.14
137 0.11
138 0.11
139 0.11
140 0.11
141 0.11
142 0.11
143 0.13
144 0.1
145 0.1
146 0.09
147 0.09
148 0.09
149 0.09
150 0.1
151 0.08
152 0.07
153 0.06
154 0.06
155 0.06
156 0.05
157 0.05
158 0.05
159 0.04
160 0.04
161 0.04
162 0.04
163 0.04
164 0.05
165 0.04
166 0.04
167 0.05
168 0.05
169 0.06
170 0.08
171 0.09
172 0.09
173 0.09
174 0.09
175 0.09
176 0.08
177 0.11
178 0.1
179 0.09
180 0.09
181 0.09
182 0.09
183 0.09
184 0.09
185 0.07
186 0.07
187 0.12
188 0.12
189 0.16
190 0.17
191 0.17
192 0.19
193 0.2
194 0.21
195 0.19
196 0.17
197 0.14
198 0.13
199 0.13
200 0.11
201 0.09
202 0.08
203 0.05
204 0.06
205 0.06
206 0.07
207 0.06
208 0.07
209 0.07
210 0.08
211 0.08
212 0.08
213 0.07
214 0.1
215 0.17
216 0.17
217 0.16
218 0.16
219 0.16
220 0.17
221 0.17
222 0.17
223 0.12
224 0.18
225 0.27
226 0.31
227 0.35
228 0.36
229 0.36
230 0.36
231 0.4
232 0.41
233 0.35
234 0.32
235 0.29
236 0.3
237 0.3
238 0.27
239 0.22
240 0.14
241 0.11
242 0.09
243 0.08
244 0.05
245 0.06
246 0.06
247 0.08
248 0.1
249 0.12
250 0.14
251 0.18
252 0.21
253 0.27
254 0.37
255 0.44
256 0.51
257 0.57
258 0.65
259 0.68
260 0.74
261 0.76
262 0.76
263 0.76
264 0.77
265 0.79
266 0.72
267 0.69
268 0.63
269 0.57
270 0.51
271 0.5
272 0.48
273 0.47
274 0.53
275 0.56
276 0.61
277 0.67
278 0.69
279 0.71
280 0.73
281 0.74
282 0.74
283 0.8
284 0.82
285 0.82
286 0.83
287 0.81
288 0.82
289 0.84
290 0.85
291 0.85
292 0.86
293 0.86
294 0.85
295 0.79
296 0.68
297 0.61
298 0.58
299 0.55
300 0.46
301 0.43
302 0.38
303 0.4
304 0.47
305 0.52
306 0.49
307 0.5
308 0.5
309 0.5
310 0.57
311 0.61
312 0.63
313 0.62
314 0.65
315 0.66
316 0.75
317 0.78
318 0.7
319 0.68
320 0.6