Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X0S0U9

Protein Details
Accession A0A1X0S0U9    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
9-34VSACAECRRKKTKCNGEQPCRNCQKSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 24, cyto_nucl 15
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences PPKKRAKIVSACAECRRKKTKCNGEQPCRNCQKSAVHCIYPSLQQDDKRNGLTRAALESIEERLKNIEDMLRAVLSNQHTIDPTFQRLPSIHNLSASSAYDN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.68
3 0.69
4 0.64
5 0.66
6 0.72
7 0.74
8 0.75
9 0.82
10 0.85
11 0.85
12 0.89
13 0.84
14 0.83
15 0.81
16 0.72
17 0.62
18 0.56
19 0.55
20 0.51
21 0.57
22 0.51
23 0.44
24 0.42
25 0.43
26 0.4
27 0.35
28 0.3
29 0.25
30 0.23
31 0.25
32 0.3
33 0.32
34 0.33
35 0.32
36 0.32
37 0.28
38 0.26
39 0.23
40 0.19
41 0.17
42 0.15
43 0.12
44 0.11
45 0.11
46 0.12
47 0.14
48 0.13
49 0.11
50 0.11
51 0.12
52 0.12
53 0.12
54 0.11
55 0.1
56 0.11
57 0.12
58 0.11
59 0.11
60 0.11
61 0.14
62 0.14
63 0.16
64 0.16
65 0.15
66 0.16
67 0.17
68 0.22
69 0.21
70 0.24
71 0.25
72 0.25
73 0.27
74 0.27
75 0.3
76 0.34
77 0.38
78 0.34
79 0.33
80 0.34
81 0.33
82 0.36