Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J0CS35

Protein Details
Accession J0CS35    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
99-128GGGERAKQREKQQRETCKKDCKGREYKIVCHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18, cyto 6, cyto_nucl 4.333, cyto_pero 3.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR015926  Cytolysin/lectin  
IPR009960  Fruit_body_lectin_fun  
KEGG adl:AURDEDRAFT_117944  -  
Pfam View protein in Pfam  
PF07367  FB_lectin  
Amino Acid Sequences MSYTFTVRVRQTTAASEWAELVESTVWHFANGGTWRAARGELVFTMGGSGTSGLLRFARGNDEYCVFAMGVHNYKPWTDCVVDCKPGETACNMHPDYYGGGERAKQREKQQRETCKKDCKGREYKIVCSGEGNSCVVEIFIE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.3
3 0.27
4 0.24
5 0.21
6 0.19
7 0.15
8 0.13
9 0.08
10 0.07
11 0.08
12 0.11
13 0.1
14 0.1
15 0.1
16 0.09
17 0.14
18 0.16
19 0.17
20 0.16
21 0.16
22 0.17
23 0.17
24 0.18
25 0.12
26 0.11
27 0.11
28 0.09
29 0.11
30 0.1
31 0.09
32 0.09
33 0.08
34 0.07
35 0.06
36 0.06
37 0.04
38 0.04
39 0.04
40 0.05
41 0.05
42 0.06
43 0.07
44 0.07
45 0.1
46 0.11
47 0.13
48 0.14
49 0.15
50 0.14
51 0.14
52 0.14
53 0.1
54 0.09
55 0.08
56 0.09
57 0.09
58 0.09
59 0.09
60 0.09
61 0.09
62 0.1
63 0.1
64 0.11
65 0.11
66 0.12
67 0.17
68 0.2
69 0.24
70 0.23
71 0.22
72 0.21
73 0.2
74 0.2
75 0.15
76 0.14
77 0.12
78 0.2
79 0.19
80 0.18
81 0.18
82 0.18
83 0.18
84 0.18
85 0.17
86 0.11
87 0.11
88 0.14
89 0.2
90 0.26
91 0.3
92 0.33
93 0.42
94 0.51
95 0.58
96 0.66
97 0.71
98 0.75
99 0.8
100 0.85
101 0.84
102 0.84
103 0.84
104 0.83
105 0.81
106 0.8
107 0.81
108 0.78
109 0.8
110 0.74
111 0.73
112 0.73
113 0.66
114 0.56
115 0.48
116 0.45
117 0.39
118 0.36
119 0.31
120 0.21
121 0.19
122 0.19