Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X0RJX6

Protein Details
Accession A0A1X0RJX6    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
52-75VPIFKKVKCSPRRKIKKGTYRVYGHydrophilic
NLS Segment(s)
PositionSequence
62-68PRRKIKK
Subcellular Location(s) nucl 12.5, cyto_nucl 11.5, cyto 9.5, mito 3
Family & Domain DBs
Amino Acid Sequences FTTKTGKGSAIDEFKNEVISMKVDEEQYPWVALQILMNIWTLNHLNASKRSVPIFKKVKCSPRRKIKKGTYRVYGDDIKEHFFCLIYEKGLTAGKAGKQLNIPRRTAYSWFEKDQK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.27
3 0.25
4 0.19
5 0.14
6 0.14
7 0.14
8 0.13
9 0.15
10 0.15
11 0.15
12 0.16
13 0.17
14 0.16
15 0.15
16 0.13
17 0.11
18 0.11
19 0.1
20 0.09
21 0.08
22 0.07
23 0.07
24 0.07
25 0.07
26 0.06
27 0.08
28 0.08
29 0.07
30 0.09
31 0.09
32 0.12
33 0.14
34 0.18
35 0.18
36 0.19
37 0.21
38 0.25
39 0.26
40 0.33
41 0.4
42 0.39
43 0.45
44 0.5
45 0.58
46 0.61
47 0.69
48 0.69
49 0.72
50 0.8
51 0.79
52 0.84
53 0.84
54 0.85
55 0.85
56 0.83
57 0.79
58 0.72
59 0.67
60 0.61
61 0.55
62 0.45
63 0.4
64 0.34
65 0.3
66 0.26
67 0.23
68 0.19
69 0.15
70 0.14
71 0.14
72 0.14
73 0.12
74 0.12
75 0.12
76 0.14
77 0.15
78 0.15
79 0.12
80 0.14
81 0.15
82 0.22
83 0.23
84 0.23
85 0.29
86 0.37
87 0.45
88 0.48
89 0.48
90 0.44
91 0.48
92 0.49
93 0.47
94 0.44
95 0.44
96 0.44