Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X0S175

Protein Details
Accession A0A1X0S175   
Localization Confidence High
Confidence Score 20.4
NoLS Segment(s)
PositionSequenceProtein Nature
104-129EDEKKEDKKEDKKEDKKEDKKKESEEAcidic
155-176YLRQREYTKRIQKKEAEERLKKBasic
NLS Segment(s)
PositionSequence
107-126KKEDKKEDKKEDKKEDKKKE
172-177ERLKKL
180-190PEVPKKDPLKK
Subcellular Location(s) nucl 18, mito 6, cyto 1, pero 1, golg 1, cyto_pero 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR013640  Vfa1  
Pfam View protein in Pfam  
PF08432  Vfa1  
Amino Acid Sequences MQNLYIARLITNERPCFVCNKFSNVVLTLADNSNTDWFPVCKSHLSDVNFCTKLGGSSKPTSPQLKVAKKEKLEARKPESDSVSDLVSTLGSAWKSWRSSKDTEDEKKEDKKEDKKEDKKEDKKKESEEEKKEEEEEQQQQQQPVRFILQKDYFYLRQREYTKRIQKKEAEERLKKLQFPEVPKKDPLKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.35
3 0.39
4 0.38
5 0.39
6 0.34
7 0.39
8 0.39
9 0.39
10 0.4
11 0.36
12 0.35
13 0.26
14 0.24
15 0.19
16 0.18
17 0.17
18 0.14
19 0.14
20 0.15
21 0.14
22 0.13
23 0.13
24 0.12
25 0.14
26 0.16
27 0.18
28 0.19
29 0.22
30 0.26
31 0.3
32 0.33
33 0.35
34 0.35
35 0.41
36 0.38
37 0.35
38 0.31
39 0.25
40 0.23
41 0.22
42 0.23
43 0.2
44 0.23
45 0.25
46 0.28
47 0.33
48 0.34
49 0.33
50 0.38
51 0.42
52 0.46
53 0.51
54 0.54
55 0.56
56 0.54
57 0.59
58 0.58
59 0.58
60 0.59
61 0.6
62 0.6
63 0.6
64 0.61
65 0.58
66 0.53
67 0.44
68 0.37
69 0.3
70 0.24
71 0.17
72 0.14
73 0.1
74 0.08
75 0.07
76 0.05
77 0.05
78 0.05
79 0.05
80 0.06
81 0.09
82 0.11
83 0.14
84 0.19
85 0.22
86 0.25
87 0.28
88 0.34
89 0.39
90 0.43
91 0.47
92 0.46
93 0.46
94 0.5
95 0.5
96 0.49
97 0.49
98 0.52
99 0.56
100 0.62
101 0.69
102 0.71
103 0.79
104 0.83
105 0.86
106 0.87
107 0.88
108 0.88
109 0.86
110 0.83
111 0.79
112 0.78
113 0.77
114 0.77
115 0.74
116 0.7
117 0.64
118 0.59
119 0.55
120 0.47
121 0.4
122 0.36
123 0.34
124 0.32
125 0.34
126 0.36
127 0.38
128 0.4
129 0.4
130 0.36
131 0.33
132 0.33
133 0.3
134 0.28
135 0.34
136 0.35
137 0.33
138 0.34
139 0.38
140 0.39
141 0.41
142 0.46
143 0.4
144 0.43
145 0.47
146 0.52
147 0.53
148 0.59
149 0.64
150 0.68
151 0.72
152 0.73
153 0.75
154 0.77
155 0.81
156 0.81
157 0.81
158 0.78
159 0.78
160 0.8
161 0.77
162 0.7
163 0.62
164 0.6
165 0.56
166 0.59
167 0.64
168 0.62
169 0.62
170 0.66