Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X0RT50

Protein Details
Accession A0A1X0RT50   
Localization Confidence High
Confidence Score 20.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MKRKKDDDPSPPKAKRNKGKGLINCRSRABasic
NLS Segment(s)
PositionSequence
4-5KK
8-20DPSPPKAKRNKGK
135-139KKEKR
Subcellular Location(s) nucl 23, mito 3
Family & Domain DBs
Amino Acid Sequences MKRKKDDDPSPPKAKRNKGKGLINCRSRAPFFVCTNTNSFKNTPLEAGDNNFQEAPLLRKDKNICTTLKAAKENTSAPGPSNVVINEKTSMPAVNRDTSVQAVLPAPTLSTSCTSTPIKASKKYQDKVDKAEALKKEKRKEQDDNK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.8
3 0.8
4 0.81
5 0.8
6 0.83
7 0.84
8 0.86
9 0.85
10 0.82
11 0.74
12 0.68
13 0.63
14 0.55
15 0.5
16 0.45
17 0.42
18 0.38
19 0.41
20 0.39
21 0.37
22 0.4
23 0.4
24 0.36
25 0.33
26 0.3
27 0.3
28 0.3
29 0.28
30 0.24
31 0.22
32 0.23
33 0.2
34 0.23
35 0.21
36 0.19
37 0.19
38 0.18
39 0.15
40 0.13
41 0.13
42 0.13
43 0.14
44 0.18
45 0.17
46 0.22
47 0.25
48 0.31
49 0.35
50 0.36
51 0.31
52 0.31
53 0.35
54 0.35
55 0.36
56 0.33
57 0.29
58 0.28
59 0.29
60 0.27
61 0.24
62 0.21
63 0.17
64 0.15
65 0.16
66 0.14
67 0.12
68 0.12
69 0.1
70 0.11
71 0.12
72 0.12
73 0.12
74 0.11
75 0.12
76 0.11
77 0.12
78 0.1
79 0.15
80 0.17
81 0.17
82 0.18
83 0.18
84 0.19
85 0.19
86 0.19
87 0.13
88 0.11
89 0.1
90 0.1
91 0.09
92 0.08
93 0.08
94 0.07
95 0.08
96 0.08
97 0.1
98 0.12
99 0.12
100 0.17
101 0.18
102 0.19
103 0.24
104 0.31
105 0.35
106 0.4
107 0.46
108 0.52
109 0.61
110 0.64
111 0.69
112 0.71
113 0.7
114 0.71
115 0.72
116 0.69
117 0.62
118 0.65
119 0.61
120 0.6
121 0.63
122 0.64
123 0.65
124 0.66
125 0.73
126 0.74