Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J0LDQ8

Protein Details
Accession J0LDQ8    Localization Confidence Medium Confidence Score 14.8
NoLS Segment(s)
PositionSequenceProtein Nature
70-93AEKCKTCQGKKPSDRKRARNDTEDHydrophilic
183-207VKKPAAKKPAEKKPVAKKSAPKCKPBasic
NLS Segment(s)
PositionSequence
180-204KPAVKKPAAKKPAEKKPVAKKSAPK
Subcellular Location(s) nucl 17.5, cyto_nucl 11.5, cyto 4.5, mito 3
Family & Domain DBs
KEGG adl:AURDEDRAFT_130962  -  
Amino Acid Sequences MSPVISAKLVSFLKNEVGDPPELGTDWCRRRDPDYEKCDVRYLTNPPPQDLRQRYAVYYIKMLEELAAIAEKCKTCQGKKPSDRKRARNDTEDSSPAGKRQKSSPIKSETSTPLKAEPAAGPSRPRGPQASSSQSTAGPSSPLKGKLAGKKEAPQPGLKTGVPDDDDCIVISSDEETVAKPAVKKPAAKKPAEKKPVAKKSAPKCKPVARPDVFSGYFSDDEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.24
3 0.21
4 0.22
5 0.22
6 0.21
7 0.2
8 0.16
9 0.15
10 0.15
11 0.16
12 0.23
13 0.28
14 0.33
15 0.35
16 0.37
17 0.41
18 0.5
19 0.55
20 0.56
21 0.57
22 0.6
23 0.59
24 0.59
25 0.6
26 0.51
27 0.46
28 0.41
29 0.4
30 0.41
31 0.44
32 0.43
33 0.41
34 0.45
35 0.45
36 0.5
37 0.48
38 0.43
39 0.44
40 0.44
41 0.42
42 0.44
43 0.44
44 0.36
45 0.33
46 0.3
47 0.23
48 0.22
49 0.21
50 0.14
51 0.1
52 0.08
53 0.06
54 0.06
55 0.06
56 0.06
57 0.09
58 0.09
59 0.09
60 0.15
61 0.2
62 0.21
63 0.31
64 0.39
65 0.48
66 0.58
67 0.68
68 0.73
69 0.79
70 0.85
71 0.86
72 0.87
73 0.87
74 0.83
75 0.79
76 0.73
77 0.67
78 0.62
79 0.54
80 0.45
81 0.37
82 0.31
83 0.28
84 0.29
85 0.26
86 0.23
87 0.25
88 0.34
89 0.4
90 0.44
91 0.48
92 0.48
93 0.49
94 0.49
95 0.49
96 0.44
97 0.41
98 0.37
99 0.31
100 0.25
101 0.23
102 0.23
103 0.2
104 0.15
105 0.13
106 0.14
107 0.15
108 0.15
109 0.16
110 0.21
111 0.21
112 0.22
113 0.2
114 0.21
115 0.27
116 0.31
117 0.37
118 0.34
119 0.34
120 0.33
121 0.31
122 0.29
123 0.23
124 0.17
125 0.12
126 0.11
127 0.12
128 0.14
129 0.16
130 0.16
131 0.19
132 0.24
133 0.3
134 0.35
135 0.38
136 0.37
137 0.42
138 0.47
139 0.5
140 0.47
141 0.44
142 0.41
143 0.4
144 0.41
145 0.35
146 0.31
147 0.25
148 0.26
149 0.24
150 0.21
151 0.19
152 0.16
153 0.17
154 0.15
155 0.15
156 0.11
157 0.09
158 0.09
159 0.08
160 0.07
161 0.07
162 0.07
163 0.06
164 0.08
165 0.09
166 0.11
167 0.12
168 0.16
169 0.25
170 0.29
171 0.35
172 0.42
173 0.52
174 0.59
175 0.63
176 0.69
177 0.7
178 0.77
179 0.79
180 0.77
181 0.76
182 0.78
183 0.83
184 0.8
185 0.77
186 0.75
187 0.77
188 0.82
189 0.79
190 0.74
191 0.73
192 0.75
193 0.78
194 0.77
195 0.77
196 0.71
197 0.71
198 0.69
199 0.69
200 0.6
201 0.51
202 0.45
203 0.39