Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X0RYU9

Protein Details
Accession A0A1X0RYU9   
Localization Confidence High
Confidence Score 17.7
NoLS Segment(s)
PositionSequenceProtein Nature
32-51KASKTSKEARNVKPKKRYEDBasic
71-104EEEARPKKSSKPKKKAPKKKPSKKKQTSEDEGSEBasic
NLS Segment(s)
PositionSequence
29-48KPVKASKTSKEARNVKPKKR
75-95RPKKSSKPKKKAPKKKPSKKK
Subcellular Location(s) nucl 21, cyto_nucl 13, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR019098  Histone_chaperone_domain_CHZ  
Gene Ontology GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF09649  CHZ  
Amino Acid Sequences MSDRRSKLLALAAKRKLEEEEEDNDDNKKPVKASKTSKEARNVKPKKRYEDTDEEEEEEEEEQSEEENYSEEEARPKKSSKPKKKAPKKKPSKKKQTSEDEGSEEDKSDVEEDELEALDTSVIIPGGRRTRGKKVDYKQFGADPEDEEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.49
3 0.43
4 0.4
5 0.37
6 0.32
7 0.31
8 0.33
9 0.35
10 0.34
11 0.33
12 0.31
13 0.28
14 0.26
15 0.23
16 0.19
17 0.23
18 0.29
19 0.37
20 0.45
21 0.51
22 0.59
23 0.64
24 0.68
25 0.72
26 0.74
27 0.74
28 0.76
29 0.77
30 0.77
31 0.8
32 0.81
33 0.79
34 0.77
35 0.73
36 0.71
37 0.71
38 0.67
39 0.64
40 0.57
41 0.5
42 0.43
43 0.38
44 0.3
45 0.2
46 0.14
47 0.08
48 0.07
49 0.05
50 0.05
51 0.05
52 0.05
53 0.04
54 0.05
55 0.05
56 0.06
57 0.06
58 0.07
59 0.12
60 0.14
61 0.16
62 0.18
63 0.2
64 0.27
65 0.37
66 0.48
67 0.54
68 0.62
69 0.7
70 0.79
71 0.88
72 0.92
73 0.93
74 0.93
75 0.93
76 0.94
77 0.95
78 0.95
79 0.95
80 0.94
81 0.93
82 0.91
83 0.9
84 0.87
85 0.82
86 0.74
87 0.65
88 0.57
89 0.49
90 0.39
91 0.3
92 0.22
93 0.15
94 0.12
95 0.1
96 0.09
97 0.07
98 0.07
99 0.07
100 0.07
101 0.07
102 0.07
103 0.06
104 0.06
105 0.05
106 0.05
107 0.05
108 0.04
109 0.04
110 0.04
111 0.05
112 0.11
113 0.17
114 0.22
115 0.28
116 0.33
117 0.44
118 0.53
119 0.6
120 0.64
121 0.68
122 0.74
123 0.76
124 0.75
125 0.7
126 0.65
127 0.6
128 0.54
129 0.46