Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J0D9N8

Protein Details
Accession J0D9N8    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
67-101RGIEMREKWKKKRSRRLRRKRRKMRARSITSPPHABasic
NLS Segment(s)
PositionSequence
72-93REKWKKKRSRRLRRKRRKMRAR
Subcellular Location(s) extr 10, plas 6, E.R. 4, mito 2, pero 2, vacu 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR007836  Ribosomal_L41  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG adl:AURDEDRAFT_174384  -  
Pfam View protein in Pfam  
PF05162  Ribosomal_L41  
Amino Acid Sequences MRFNVAAVLVALTALAVAKPGANVLVARQVGDPCSDAFDGFRDCICNVILNPLLALQCFNVLTGTLRGIEMREKWKKKRSRRLRRKRRKMRARSITSPPHATNAQVKPRYVVCTSFQSFFKLVNRFILPAVREPVPCCPSPEEHAT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.03
3 0.03
4 0.04
5 0.04
6 0.04
7 0.05
8 0.05
9 0.06
10 0.06
11 0.07
12 0.14
13 0.13
14 0.14
15 0.15
16 0.16
17 0.16
18 0.17
19 0.17
20 0.1
21 0.14
22 0.13
23 0.11
24 0.11
25 0.13
26 0.13
27 0.13
28 0.13
29 0.12
30 0.11
31 0.13
32 0.12
33 0.12
34 0.1
35 0.14
36 0.14
37 0.12
38 0.12
39 0.12
40 0.12
41 0.1
42 0.1
43 0.06
44 0.06
45 0.06
46 0.06
47 0.05
48 0.05
49 0.06
50 0.06
51 0.07
52 0.06
53 0.06
54 0.06
55 0.07
56 0.09
57 0.1
58 0.18
59 0.27
60 0.32
61 0.39
62 0.48
63 0.57
64 0.65
65 0.74
66 0.77
67 0.8
68 0.86
69 0.91
70 0.94
71 0.96
72 0.97
73 0.97
74 0.97
75 0.96
76 0.96
77 0.95
78 0.95
79 0.91
80 0.86
81 0.83
82 0.8
83 0.73
84 0.68
85 0.57
86 0.5
87 0.42
88 0.37
89 0.37
90 0.36
91 0.41
92 0.39
93 0.39
94 0.38
95 0.4
96 0.42
97 0.35
98 0.31
99 0.25
100 0.3
101 0.33
102 0.33
103 0.32
104 0.31
105 0.3
106 0.31
107 0.34
108 0.3
109 0.29
110 0.31
111 0.32
112 0.29
113 0.3
114 0.32
115 0.27
116 0.27
117 0.3
118 0.28
119 0.28
120 0.29
121 0.36
122 0.36
123 0.35
124 0.34
125 0.34
126 0.35