Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X0RM39

Protein Details
Accession A0A1X0RM39   
Localization Confidence Medium
Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
101-124EPEPKRKKAKVDTKKNIERNKKENBasic
128-150KENIKMAKKRKDRDQQTESKRRGBasic
NLS Segment(s)
PositionSequence
104-161PKRKKAKVDTKKNIERNKKENVGEKENIKMAKKRKDRDQQTESKRRGHAIDEKKMRIP
Subcellular Location(s) nucl 16, mito_nucl 12.833, cyto_nucl 9.833, mito 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR041232  NPL  
Gene Ontology GO:0016853  F:isomerase activity  
Pfam View protein in Pfam  
PF17800  NPL  
Amino Acid Sequences MKIQGIYGVKVRPRSRITIESGGSFQLTMASLSSFKSLERTSLYVETKKQKILLCSLIPCTRDQQLLNFTRLEGETVTFIVKGKNTVQLSGNYISLEDELEPEPKRKKAKVDTKKNIERNKKENVGEKENIKMAKKRKDRDQQTESKRRGHAIDEKKMRIPESKRHNQAVQDEAKQVKSKVDEKVLQDERIVDDIVSM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.52
3 0.53
4 0.56
5 0.55
6 0.54
7 0.48
8 0.45
9 0.39
10 0.32
11 0.26
12 0.18
13 0.12
14 0.1
15 0.08
16 0.08
17 0.08
18 0.08
19 0.09
20 0.11
21 0.1
22 0.09
23 0.14
24 0.14
25 0.15
26 0.18
27 0.19
28 0.21
29 0.27
30 0.31
31 0.3
32 0.36
33 0.41
34 0.41
35 0.41
36 0.42
37 0.39
38 0.38
39 0.39
40 0.39
41 0.34
42 0.33
43 0.36
44 0.35
45 0.33
46 0.31
47 0.29
48 0.25
49 0.25
50 0.23
51 0.22
52 0.27
53 0.3
54 0.3
55 0.28
56 0.25
57 0.24
58 0.23
59 0.2
60 0.12
61 0.09
62 0.08
63 0.08
64 0.09
65 0.07
66 0.07
67 0.08
68 0.08
69 0.09
70 0.1
71 0.16
72 0.16
73 0.18
74 0.19
75 0.19
76 0.22
77 0.21
78 0.21
79 0.14
80 0.13
81 0.12
82 0.1
83 0.09
84 0.06
85 0.06
86 0.06
87 0.09
88 0.09
89 0.13
90 0.15
91 0.2
92 0.24
93 0.26
94 0.33
95 0.41
96 0.51
97 0.58
98 0.67
99 0.72
100 0.78
101 0.84
102 0.85
103 0.84
104 0.83
105 0.8
106 0.74
107 0.72
108 0.69
109 0.63
110 0.64
111 0.61
112 0.58
113 0.54
114 0.5
115 0.44
116 0.41
117 0.41
118 0.35
119 0.34
120 0.36
121 0.42
122 0.5
123 0.54
124 0.61
125 0.69
126 0.75
127 0.79
128 0.8
129 0.8
130 0.82
131 0.86
132 0.79
133 0.76
134 0.68
135 0.61
136 0.54
137 0.5
138 0.49
139 0.48
140 0.54
141 0.55
142 0.56
143 0.58
144 0.58
145 0.55
146 0.53
147 0.49
148 0.49
149 0.51
150 0.58
151 0.61
152 0.65
153 0.66
154 0.64
155 0.63
156 0.62
157 0.57
158 0.5
159 0.49
160 0.45
161 0.45
162 0.43
163 0.38
164 0.35
165 0.35
166 0.37
167 0.38
168 0.44
169 0.46
170 0.47
171 0.56
172 0.56
173 0.52
174 0.48
175 0.43
176 0.38
177 0.34
178 0.31