Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J0CW93

Protein Details
Accession J0CW93    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
253-280LFTVSRRVRRLVRRARRGRRGGARDEDEBasic
NLS Segment(s)
PositionSequence
258-274RRVRRLVRRARRGRRGG
Subcellular Location(s) extr 19, cyto 3, mito 2, E.R. 2, cyto_pero 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG adl:AURDEDRAFT_176134  -  
Amino Acid Sequences MYTITRTLLATLFAYPLARASFVEPIVTFDESDPRVQCSPPPAALTCAGLENCQQTNSWWAVDGKDYHGGRMVAIDSPASCTSITFYGLRIENGANGTYAVDGSDRTPFTWRITNERLGGGVTSIFRAAGLRFGKHVLEFTVDAVKGTLASVDFFAVTDPSLEKDVPQPSRPGGFVVTQNFVPGAEPTIPPTPPTAPIAPVPPVAPALPISPVSNIAVPESSSHSQDDFFSNCSPFVVGALSILAVVVGAGVLFTVSRRVRRLVRRARRGRRGGARDEDETTVVFDEGAEEEGKPLLKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.11
3 0.13
4 0.12
5 0.12
6 0.12
7 0.13
8 0.17
9 0.17
10 0.19
11 0.17
12 0.19
13 0.21
14 0.21
15 0.19
16 0.16
17 0.22
18 0.21
19 0.25
20 0.23
21 0.24
22 0.25
23 0.25
24 0.27
25 0.26
26 0.3
27 0.28
28 0.31
29 0.28
30 0.29
31 0.3
32 0.28
33 0.23
34 0.22
35 0.19
36 0.17
37 0.17
38 0.19
39 0.18
40 0.17
41 0.17
42 0.14
43 0.19
44 0.2
45 0.18
46 0.16
47 0.16
48 0.16
49 0.2
50 0.2
51 0.18
52 0.25
53 0.25
54 0.23
55 0.26
56 0.25
57 0.21
58 0.21
59 0.19
60 0.12
61 0.12
62 0.12
63 0.08
64 0.12
65 0.12
66 0.12
67 0.11
68 0.1
69 0.11
70 0.12
71 0.14
72 0.11
73 0.11
74 0.15
75 0.16
76 0.16
77 0.16
78 0.15
79 0.14
80 0.15
81 0.14
82 0.1
83 0.09
84 0.09
85 0.07
86 0.07
87 0.06
88 0.05
89 0.05
90 0.06
91 0.09
92 0.1
93 0.1
94 0.13
95 0.15
96 0.17
97 0.23
98 0.23
99 0.27
100 0.31
101 0.34
102 0.33
103 0.32
104 0.29
105 0.23
106 0.22
107 0.14
108 0.11
109 0.07
110 0.06
111 0.06
112 0.05
113 0.05
114 0.06
115 0.06
116 0.11
117 0.12
118 0.12
119 0.13
120 0.14
121 0.14
122 0.14
123 0.14
124 0.09
125 0.09
126 0.09
127 0.09
128 0.11
129 0.1
130 0.1
131 0.1
132 0.09
133 0.07
134 0.06
135 0.06
136 0.03
137 0.04
138 0.04
139 0.04
140 0.04
141 0.04
142 0.04
143 0.04
144 0.04
145 0.04
146 0.04
147 0.05
148 0.07
149 0.06
150 0.07
151 0.12
152 0.17
153 0.2
154 0.21
155 0.22
156 0.22
157 0.23
158 0.23
159 0.19
160 0.15
161 0.15
162 0.17
163 0.18
164 0.18
165 0.16
166 0.16
167 0.15
168 0.13
169 0.12
170 0.08
171 0.08
172 0.08
173 0.08
174 0.11
175 0.14
176 0.14
177 0.14
178 0.16
179 0.16
180 0.16
181 0.19
182 0.17
183 0.16
184 0.18
185 0.2
186 0.19
187 0.18
188 0.16
189 0.14
190 0.14
191 0.12
192 0.11
193 0.1
194 0.09
195 0.1
196 0.1
197 0.1
198 0.1
199 0.11
200 0.12
201 0.12
202 0.12
203 0.11
204 0.11
205 0.1
206 0.11
207 0.16
208 0.16
209 0.16
210 0.17
211 0.17
212 0.17
213 0.18
214 0.2
215 0.16
216 0.17
217 0.18
218 0.18
219 0.17
220 0.17
221 0.16
222 0.12
223 0.11
224 0.1
225 0.07
226 0.06
227 0.06
228 0.06
229 0.05
230 0.05
231 0.04
232 0.03
233 0.03
234 0.02
235 0.02
236 0.02
237 0.02
238 0.02
239 0.02
240 0.02
241 0.03
242 0.1
243 0.13
244 0.18
245 0.21
246 0.27
247 0.36
248 0.46
249 0.57
250 0.61
251 0.7
252 0.77
253 0.85
254 0.9
255 0.92
256 0.9
257 0.89
258 0.89
259 0.86
260 0.83
261 0.81
262 0.76
263 0.68
264 0.64
265 0.55
266 0.45
267 0.38
268 0.31
269 0.22
270 0.17
271 0.13
272 0.1
273 0.09
274 0.09
275 0.1
276 0.1
277 0.09
278 0.09
279 0.11