Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X0RP54

Protein Details
Accession A0A1X0RP54    Localization Confidence Low Confidence Score 6.5
NoLS Segment(s)
PositionSequenceProtein Nature
71-101LDEKKQKQLSSRPSNRQYHRKQNRENIKASNHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences MLSKLVASKSLSPVFARAIHTTSILQNTAVSRIPSSAPKGTVLKGLQYLKDRPEIVALDDTEYPEWLWDLLDEKKQKQLSSRPSNRQYHRKQNRENIKASNFMKDKKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.29
3 0.29
4 0.24
5 0.24
6 0.23
7 0.24
8 0.23
9 0.22
10 0.21
11 0.18
12 0.16
13 0.16
14 0.15
15 0.16
16 0.16
17 0.15
18 0.12
19 0.13
20 0.14
21 0.16
22 0.2
23 0.2
24 0.19
25 0.21
26 0.23
27 0.22
28 0.26
29 0.23
30 0.2
31 0.22
32 0.23
33 0.23
34 0.25
35 0.26
36 0.23
37 0.26
38 0.25
39 0.2
40 0.21
41 0.18
42 0.16
43 0.16
44 0.14
45 0.12
46 0.12
47 0.13
48 0.11
49 0.1
50 0.09
51 0.07
52 0.07
53 0.05
54 0.05
55 0.04
56 0.07
57 0.09
58 0.16
59 0.19
60 0.2
61 0.27
62 0.29
63 0.3
64 0.34
65 0.41
66 0.45
67 0.54
68 0.62
69 0.66
70 0.73
71 0.81
72 0.82
73 0.84
74 0.83
75 0.84
76 0.85
77 0.85
78 0.86
79 0.87
80 0.9
81 0.87
82 0.83
83 0.8
84 0.73
85 0.72
86 0.63
87 0.63
88 0.57