Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J0DC53

Protein Details
Accession J0DC53    Localization Confidence High Confidence Score 18.6
NoLS Segment(s)
PositionSequenceProtein Nature
95-114RERICRRCWNPLARQKERDHBasic
190-212APGAPGKKGKKKSDKRVRILEPHBasic
259-285PERPAAPSLRRKRDKHRKQTPGAQPGABasic
NLS Segment(s)
PositionSequence
187-207RGAAPGAPGKKGKKKSDKRVR
264-276APSLRRKRDKHRK
Subcellular Location(s) mito 13, nucl 9, cyto 3
Family & Domain DBs
KEGG adl:AURDEDRAFT_171399  -  
Amino Acid Sequences MRKAGRRPDGSLFTESEIIEDLRAHSAAFKTVRLADSAEPASWISRADVRALKERSTLLVNLATAEDAASFVAMRRCLFAFGCPCEPGEYAPQERERICRRCWNPLARQKERDHACRERCRLCGGSHAEEEHTCGECDVLAKPCAHIPLKCVNCGLGHAADDGICEYRRRARGTLATAPPMAGGSQRGAAPGAPGKKGKKKSDKRVRILEPHEPFPTDPAPPSPCSPPSPTPPPPTPPPPPLPLPLGQAPPAATPDTAPERPAAPSLRRKRDKHRKQTPGAQPGAMPHGTGPDTRQRAVLASKSAAASVAAPLPAPETAASLAPEVTPPLAPDVAAKPAARPGAALERDGASSPVIDEADMSAVRDLVGPVSAQVRTLAPAAQAPAPACQEVRGALSLHAWRPRTPNARADGGGPPTSSDDYASAVSWAAEMQASRGKANMMGKSDKSLQKLALDMAAAAASYNPAAGSDTDLTPADA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.36
3 0.29
4 0.23
5 0.19
6 0.16
7 0.15
8 0.14
9 0.13
10 0.14
11 0.13
12 0.14
13 0.15
14 0.21
15 0.22
16 0.21
17 0.22
18 0.26
19 0.27
20 0.25
21 0.27
22 0.22
23 0.26
24 0.27
25 0.24
26 0.21
27 0.21
28 0.2
29 0.18
30 0.17
31 0.13
32 0.16
33 0.16
34 0.21
35 0.25
36 0.28
37 0.37
38 0.39
39 0.39
40 0.37
41 0.37
42 0.34
43 0.34
44 0.3
45 0.24
46 0.23
47 0.21
48 0.19
49 0.18
50 0.16
51 0.12
52 0.11
53 0.08
54 0.06
55 0.05
56 0.05
57 0.04
58 0.07
59 0.1
60 0.12
61 0.12
62 0.14
63 0.15
64 0.17
65 0.18
66 0.22
67 0.24
68 0.28
69 0.3
70 0.29
71 0.29
72 0.29
73 0.29
74 0.25
75 0.26
76 0.26
77 0.26
78 0.31
79 0.33
80 0.35
81 0.36
82 0.42
83 0.45
84 0.45
85 0.48
86 0.53
87 0.53
88 0.6
89 0.67
90 0.68
91 0.69
92 0.72
93 0.78
94 0.76
95 0.8
96 0.73
97 0.74
98 0.72
99 0.69
100 0.69
101 0.68
102 0.69
103 0.71
104 0.74
105 0.7
106 0.65
107 0.63
108 0.57
109 0.48
110 0.48
111 0.44
112 0.41
113 0.38
114 0.37
115 0.33
116 0.3
117 0.31
118 0.24
119 0.19
120 0.14
121 0.13
122 0.11
123 0.1
124 0.11
125 0.11
126 0.12
127 0.13
128 0.13
129 0.14
130 0.16
131 0.2
132 0.21
133 0.2
134 0.21
135 0.28
136 0.3
137 0.31
138 0.29
139 0.25
140 0.23
141 0.24
142 0.22
143 0.13
144 0.12
145 0.11
146 0.1
147 0.09
148 0.09
149 0.09
150 0.08
151 0.08
152 0.08
153 0.09
154 0.16
155 0.21
156 0.25
157 0.25
158 0.29
159 0.34
160 0.4
161 0.47
162 0.43
163 0.4
164 0.37
165 0.35
166 0.3
167 0.24
168 0.18
169 0.1
170 0.08
171 0.06
172 0.08
173 0.08
174 0.08
175 0.08
176 0.08
177 0.09
178 0.12
179 0.14
180 0.15
181 0.19
182 0.24
183 0.32
184 0.4
185 0.48
186 0.56
187 0.63
188 0.73
189 0.8
190 0.85
191 0.84
192 0.85
193 0.82
194 0.79
195 0.74
196 0.72
197 0.63
198 0.56
199 0.5
200 0.41
201 0.35
202 0.29
203 0.26
204 0.18
205 0.15
206 0.15
207 0.17
208 0.18
209 0.2
210 0.2
211 0.21
212 0.23
213 0.28
214 0.28
215 0.31
216 0.37
217 0.4
218 0.43
219 0.43
220 0.45
221 0.45
222 0.47
223 0.46
224 0.43
225 0.42
226 0.4
227 0.39
228 0.37
229 0.35
230 0.3
231 0.28
232 0.26
233 0.23
234 0.2
235 0.19
236 0.17
237 0.14
238 0.14
239 0.12
240 0.09
241 0.08
242 0.1
243 0.15
244 0.15
245 0.15
246 0.14
247 0.14
248 0.15
249 0.18
250 0.18
251 0.19
252 0.29
253 0.37
254 0.47
255 0.55
256 0.59
257 0.68
258 0.76
259 0.82
260 0.83
261 0.84
262 0.84
263 0.82
264 0.87
265 0.85
266 0.83
267 0.73
268 0.63
269 0.52
270 0.44
271 0.41
272 0.3
273 0.21
274 0.12
275 0.12
276 0.13
277 0.12
278 0.13
279 0.17
280 0.2
281 0.21
282 0.21
283 0.19
284 0.21
285 0.23
286 0.24
287 0.18
288 0.16
289 0.17
290 0.16
291 0.16
292 0.14
293 0.12
294 0.09
295 0.08
296 0.08
297 0.07
298 0.06
299 0.06
300 0.07
301 0.07
302 0.07
303 0.06
304 0.06
305 0.07
306 0.08
307 0.08
308 0.08
309 0.08
310 0.08
311 0.08
312 0.07
313 0.07
314 0.06
315 0.06
316 0.08
317 0.08
318 0.08
319 0.1
320 0.11
321 0.13
322 0.15
323 0.15
324 0.14
325 0.17
326 0.18
327 0.16
328 0.14
329 0.15
330 0.21
331 0.22
332 0.22
333 0.19
334 0.19
335 0.2
336 0.2
337 0.18
338 0.09
339 0.09
340 0.08
341 0.09
342 0.08
343 0.07
344 0.07
345 0.06
346 0.08
347 0.08
348 0.09
349 0.07
350 0.07
351 0.07
352 0.08
353 0.08
354 0.06
355 0.06
356 0.06
357 0.07
358 0.09
359 0.09
360 0.09
361 0.1
362 0.1
363 0.11
364 0.12
365 0.12
366 0.1
367 0.11
368 0.13
369 0.13
370 0.15
371 0.14
372 0.16
373 0.17
374 0.17
375 0.16
376 0.15
377 0.14
378 0.14
379 0.15
380 0.14
381 0.13
382 0.13
383 0.17
384 0.2
385 0.24
386 0.28
387 0.28
388 0.3
389 0.35
390 0.43
391 0.47
392 0.48
393 0.51
394 0.5
395 0.53
396 0.5
397 0.48
398 0.44
399 0.41
400 0.38
401 0.31
402 0.27
403 0.25
404 0.26
405 0.23
406 0.19
407 0.15
408 0.15
409 0.16
410 0.15
411 0.12
412 0.11
413 0.1
414 0.09
415 0.08
416 0.07
417 0.07
418 0.07
419 0.09
420 0.14
421 0.15
422 0.15
423 0.16
424 0.16
425 0.2
426 0.26
427 0.29
428 0.3
429 0.34
430 0.35
431 0.4
432 0.47
433 0.47
434 0.46
435 0.45
436 0.42
437 0.38
438 0.39
439 0.35
440 0.29
441 0.24
442 0.19
443 0.16
444 0.13
445 0.1
446 0.08
447 0.07
448 0.06
449 0.05
450 0.06
451 0.05
452 0.05
453 0.07
454 0.07
455 0.12
456 0.15
457 0.15
458 0.17