Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X0RJQ7

Protein Details
Accession A0A1X0RJQ7   
Localization Confidence Low
Confidence Score 7.3
NoLS Segment(s)
PositionSequenceProtein Nature
264-283FNCFYCKKEGHRKPECPDWLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11.5, cyto_nucl 11.166, cyto 9.5, cyto_mito 7.166, cyto_pero 6.666, mito 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR005162  Retrotrans_gag_dom  
IPR001878  Znf_CCHC  
IPR036875  Znf_CCHC_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF03732  Retrotrans_gag  
PROSITE View protein in PROSITE  
PS50158  ZF_CCHC  
Amino Acid Sequences MESNSRSAGGHLVRFLNDIKDFSGSVNPRVENNQRLENPLVWLKRLDRLKELAHLSDKEILLIAADHLVSKAEIWYDIACKGITTWSEFTKLFKSKYCAGMEDLWWSQIRTMKQAPGESVEDIDLKLRELFTLVGVVDESIMVRAFLDAIVPQIAWEVEKNNSSTSRAKLDDVVKSAARFEAVMLKYRAKGFDVKGGVNKSWDLDLDSVYSGRNDGSKSAPDAHSINSSSMDDLLREFRELKISLVQSVPPSVPSGDNRDRRGFNCFYCKKEGHRKPECPDWLAVKKQESGSPPATGSNAIPLNAGKEQGHRQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.28
3 0.27
4 0.25
5 0.23
6 0.21
7 0.21
8 0.21
9 0.2
10 0.27
11 0.24
12 0.28
13 0.32
14 0.31
15 0.31
16 0.38
17 0.43
18 0.42
19 0.44
20 0.48
21 0.44
22 0.48
23 0.49
24 0.44
25 0.42
26 0.41
27 0.38
28 0.31
29 0.33
30 0.3
31 0.34
32 0.39
33 0.38
34 0.36
35 0.39
36 0.4
37 0.43
38 0.45
39 0.41
40 0.4
41 0.38
42 0.35
43 0.36
44 0.34
45 0.27
46 0.24
47 0.19
48 0.14
49 0.13
50 0.11
51 0.06
52 0.06
53 0.06
54 0.06
55 0.06
56 0.06
57 0.06
58 0.06
59 0.06
60 0.06
61 0.07
62 0.08
63 0.09
64 0.1
65 0.11
66 0.1
67 0.09
68 0.1
69 0.11
70 0.11
71 0.14
72 0.16
73 0.16
74 0.2
75 0.2
76 0.22
77 0.27
78 0.31
79 0.28
80 0.3
81 0.34
82 0.35
83 0.42
84 0.42
85 0.36
86 0.34
87 0.34
88 0.31
89 0.3
90 0.26
91 0.2
92 0.19
93 0.17
94 0.16
95 0.18
96 0.18
97 0.19
98 0.21
99 0.23
100 0.25
101 0.27
102 0.26
103 0.25
104 0.26
105 0.21
106 0.19
107 0.16
108 0.13
109 0.12
110 0.13
111 0.09
112 0.08
113 0.08
114 0.08
115 0.07
116 0.07
117 0.07
118 0.06
119 0.07
120 0.06
121 0.06
122 0.05
123 0.05
124 0.04
125 0.04
126 0.04
127 0.03
128 0.03
129 0.03
130 0.03
131 0.03
132 0.03
133 0.03
134 0.03
135 0.03
136 0.04
137 0.04
138 0.04
139 0.04
140 0.04
141 0.04
142 0.04
143 0.04
144 0.06
145 0.07
146 0.08
147 0.09
148 0.1
149 0.11
150 0.15
151 0.17
152 0.18
153 0.21
154 0.2
155 0.2
156 0.24
157 0.26
158 0.26
159 0.25
160 0.25
161 0.22
162 0.21
163 0.21
164 0.16
165 0.13
166 0.1
167 0.08
168 0.13
169 0.13
170 0.18
171 0.19
172 0.2
173 0.22
174 0.23
175 0.24
176 0.18
177 0.21
178 0.18
179 0.23
180 0.25
181 0.24
182 0.27
183 0.29
184 0.28
185 0.25
186 0.24
187 0.18
188 0.16
189 0.14
190 0.12
191 0.1
192 0.1
193 0.1
194 0.1
195 0.1
196 0.09
197 0.09
198 0.07
199 0.07
200 0.09
201 0.08
202 0.09
203 0.12
204 0.13
205 0.16
206 0.2
207 0.21
208 0.21
209 0.22
210 0.22
211 0.23
212 0.23
213 0.21
214 0.18
215 0.18
216 0.15
217 0.15
218 0.14
219 0.1
220 0.11
221 0.13
222 0.12
223 0.13
224 0.14
225 0.14
226 0.19
227 0.19
228 0.19
229 0.22
230 0.22
231 0.23
232 0.23
233 0.24
234 0.2
235 0.21
236 0.2
237 0.14
238 0.15
239 0.14
240 0.17
241 0.18
242 0.26
243 0.33
244 0.4
245 0.44
246 0.49
247 0.52
248 0.5
249 0.54
250 0.5
251 0.46
252 0.51
253 0.5
254 0.49
255 0.53
256 0.55
257 0.57
258 0.63
259 0.67
260 0.67
261 0.72
262 0.76
263 0.74
264 0.81
265 0.78
266 0.7
267 0.65
268 0.63
269 0.61
270 0.59
271 0.58
272 0.52
273 0.5
274 0.49
275 0.5
276 0.45
277 0.44
278 0.41
279 0.38
280 0.35
281 0.32
282 0.31
283 0.28
284 0.24
285 0.24
286 0.23
287 0.2
288 0.21
289 0.19
290 0.22
291 0.22
292 0.24
293 0.18