Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J0CWE4

Protein Details
Accession J0CWE4   
Localization Confidence Medium
Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
267-302GEAPPKKTLKRKRGTPPPPLTQKKRQKKAGDREYGVBasic
NLS Segment(s)
PositionSequence
269-295APPKKTLKRKRGTPPPPLTQKKRQKKA
490-521KKDGASRGRGRGGKSARGGGRKKNDPLKKFGR
Subcellular Location(s) cyto 20.5, cyto_nucl 14.333, cyto_mito 11.166, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR011545  DEAD/DEAH_box_helicase_dom  
IPR014001  Helicase_ATP-bd  
IPR001650  Helicase_C  
IPR027417  P-loop_NTPase  
Gene Ontology GO:0005524  F:ATP binding  
GO:0004386  F:helicase activity  
GO:0016787  F:hydrolase activity  
GO:0003723  F:RNA binding  
KEGG adl:AURDEDRAFT_117521  -  
Pfam View protein in Pfam  
PF00270  DEAD  
PF00271  Helicase_C  
PROSITE View protein in PROSITE  
PS51192  HELICASE_ATP_BIND_1  
PS51194  HELICASE_CTER  
CDD cd18787  SF2_C_DEAD  
Amino Acid Sequences MLVPTRELAEQVSNLLKGLLKYCDKDLTFVNVAAGSTSHLKSILADSPDIVISTPARALSLLQSKVLTLALMESLVIDEADLILSYGHDEDMKQILGGGFFPSVYQSYLMSATMTKDVETLKGLVLRSPAILRLEEDEDVAANLSQYAVRCNEVDKFLLTYVMLKLKLVKGKCLVFVNDVDRCYRLKLFLEQFSIKSCVLNSELPLNSRFHIVQEFNKGVYDYIIATDESGEKAEADSDAESESEAEAEDEDEADPDMLPTQRPAEGEAPPKKTLKRKRGTPPPPLTQKKRQKKAGDREYGVSRGVDFVDVACVLNFDLPSSARAYTHRVGRTARAGKSGMALAFVVPKDEFGKNKVVGGVPSTKRDEKVFKRIEEDQAARGSKIAEYAFDMKQVNSFRYRMDDALRAVTRAAIKEARVKELKSEILNSDKLKAHFEDNPLDLEYLRHDKALHPTRVQPHMKHVPKYLMPRIAAVPGAAQADEVGFVPFKKDGASRGRGRGGKSARGGGRKKNDPLKKFGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.2
3 0.19
4 0.17
5 0.2
6 0.23
7 0.25
8 0.27
9 0.31
10 0.38
11 0.36
12 0.37
13 0.37
14 0.37
15 0.35
16 0.33
17 0.3
18 0.23
19 0.23
20 0.21
21 0.18
22 0.13
23 0.15
24 0.15
25 0.14
26 0.14
27 0.14
28 0.15
29 0.19
30 0.22
31 0.19
32 0.19
33 0.19
34 0.2
35 0.21
36 0.19
37 0.16
38 0.12
39 0.1
40 0.11
41 0.12
42 0.1
43 0.1
44 0.1
45 0.11
46 0.16
47 0.24
48 0.23
49 0.24
50 0.24
51 0.23
52 0.24
53 0.23
54 0.16
55 0.08
56 0.08
57 0.07
58 0.06
59 0.06
60 0.05
61 0.05
62 0.06
63 0.05
64 0.04
65 0.04
66 0.04
67 0.04
68 0.04
69 0.04
70 0.03
71 0.04
72 0.05
73 0.05
74 0.05
75 0.06
76 0.06
77 0.09
78 0.11
79 0.11
80 0.1
81 0.11
82 0.11
83 0.11
84 0.12
85 0.1
86 0.08
87 0.08
88 0.08
89 0.08
90 0.09
91 0.09
92 0.1
93 0.08
94 0.1
95 0.11
96 0.11
97 0.1
98 0.1
99 0.11
100 0.13
101 0.13
102 0.11
103 0.12
104 0.13
105 0.13
106 0.14
107 0.13
108 0.12
109 0.15
110 0.15
111 0.15
112 0.16
113 0.15
114 0.15
115 0.15
116 0.16
117 0.15
118 0.15
119 0.14
120 0.16
121 0.18
122 0.16
123 0.16
124 0.13
125 0.12
126 0.11
127 0.11
128 0.07
129 0.05
130 0.05
131 0.05
132 0.06
133 0.06
134 0.08
135 0.09
136 0.11
137 0.11
138 0.13
139 0.15
140 0.16
141 0.17
142 0.15
143 0.15
144 0.14
145 0.15
146 0.13
147 0.12
148 0.12
149 0.15
150 0.14
151 0.13
152 0.15
153 0.19
154 0.24
155 0.23
156 0.25
157 0.26
158 0.28
159 0.31
160 0.31
161 0.29
162 0.26
163 0.28
164 0.28
165 0.27
166 0.26
167 0.23
168 0.22
169 0.21
170 0.21
171 0.19
172 0.17
173 0.16
174 0.22
175 0.26
176 0.28
177 0.33
178 0.31
179 0.31
180 0.31
181 0.32
182 0.25
183 0.21
184 0.17
185 0.14
186 0.16
187 0.16
188 0.14
189 0.16
190 0.17
191 0.18
192 0.2
193 0.19
194 0.17
195 0.18
196 0.17
197 0.13
198 0.16
199 0.17
200 0.18
201 0.23
202 0.23
203 0.22
204 0.22
205 0.21
206 0.17
207 0.15
208 0.13
209 0.07
210 0.06
211 0.07
212 0.06
213 0.06
214 0.07
215 0.07
216 0.06
217 0.06
218 0.06
219 0.05
220 0.05
221 0.05
222 0.05
223 0.05
224 0.05
225 0.05
226 0.05
227 0.05
228 0.05
229 0.05
230 0.05
231 0.04
232 0.04
233 0.04
234 0.03
235 0.04
236 0.03
237 0.04
238 0.04
239 0.04
240 0.04
241 0.04
242 0.04
243 0.04
244 0.05
245 0.05
246 0.05
247 0.06
248 0.07
249 0.08
250 0.08
251 0.11
252 0.12
253 0.16
254 0.24
255 0.29
256 0.32
257 0.33
258 0.36
259 0.37
260 0.44
261 0.5
262 0.53
263 0.55
264 0.6
265 0.68
266 0.77
267 0.81
268 0.83
269 0.8
270 0.78
271 0.8
272 0.79
273 0.76
274 0.76
275 0.78
276 0.78
277 0.79
278 0.8
279 0.8
280 0.82
281 0.86
282 0.85
283 0.83
284 0.74
285 0.69
286 0.63
287 0.55
288 0.45
289 0.34
290 0.23
291 0.16
292 0.14
293 0.1
294 0.07
295 0.06
296 0.06
297 0.06
298 0.06
299 0.05
300 0.05
301 0.05
302 0.06
303 0.06
304 0.05
305 0.06
306 0.06
307 0.07
308 0.09
309 0.09
310 0.09
311 0.11
312 0.17
313 0.19
314 0.26
315 0.27
316 0.28
317 0.29
318 0.32
319 0.4
320 0.4
321 0.38
322 0.35
323 0.34
324 0.31
325 0.31
326 0.29
327 0.2
328 0.14
329 0.13
330 0.09
331 0.11
332 0.11
333 0.11
334 0.08
335 0.09
336 0.12
337 0.14
338 0.15
339 0.16
340 0.22
341 0.21
342 0.23
343 0.24
344 0.21
345 0.2
346 0.22
347 0.28
348 0.23
349 0.27
350 0.31
351 0.31
352 0.32
353 0.36
354 0.42
355 0.4
356 0.49
357 0.51
358 0.48
359 0.51
360 0.54
361 0.56
362 0.53
363 0.49
364 0.41
365 0.4
366 0.39
367 0.34
368 0.3
369 0.25
370 0.18
371 0.19
372 0.16
373 0.11
374 0.13
375 0.18
376 0.17
377 0.2
378 0.21
379 0.18
380 0.23
381 0.24
382 0.24
383 0.24
384 0.24
385 0.22
386 0.27
387 0.29
388 0.26
389 0.28
390 0.29
391 0.27
392 0.33
393 0.33
394 0.28
395 0.25
396 0.26
397 0.24
398 0.21
399 0.23
400 0.18
401 0.2
402 0.28
403 0.3
404 0.34
405 0.35
406 0.35
407 0.35
408 0.38
409 0.4
410 0.34
411 0.36
412 0.32
413 0.33
414 0.38
415 0.34
416 0.35
417 0.35
418 0.34
419 0.35
420 0.33
421 0.32
422 0.32
423 0.36
424 0.35
425 0.32
426 0.33
427 0.3
428 0.29
429 0.24
430 0.2
431 0.21
432 0.22
433 0.21
434 0.2
435 0.19
436 0.22
437 0.33
438 0.42
439 0.43
440 0.41
441 0.48
442 0.54
443 0.63
444 0.66
445 0.58
446 0.58
447 0.63
448 0.67
449 0.64
450 0.63
451 0.61
452 0.6
453 0.67
454 0.65
455 0.61
456 0.55
457 0.52
458 0.49
459 0.43
460 0.37
461 0.28
462 0.21
463 0.16
464 0.16
465 0.13
466 0.11
467 0.09
468 0.09
469 0.09
470 0.09
471 0.08
472 0.07
473 0.08
474 0.1
475 0.11
476 0.11
477 0.13
478 0.15
479 0.21
480 0.29
481 0.38
482 0.43
483 0.5
484 0.58
485 0.59
486 0.61
487 0.63
488 0.61
489 0.6
490 0.58
491 0.59
492 0.57
493 0.63
494 0.66
495 0.66
496 0.7
497 0.7
498 0.75
499 0.77
500 0.8
501 0.76