Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2G4T9C0

Protein Details
Accession A0A2G4T9C0    Localization Confidence Low Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
56-80KTLFNIKHVKNKRRKPNEEYKDTNIHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 13.5, cyto 12.5, nucl 11.5
Family & Domain DBs
Amino Acid Sequences MYDLLERAYKNKFPVPPQCLTEEYSFETRKQETVLTGSTNFKDSYGSIVWQDKLWKTLFNIKHVKNKRRKPNEEYKDTNIELDYGWKTDGYMVAVLFKRKTVGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.55
3 0.54
4 0.54
5 0.53
6 0.48
7 0.46
8 0.41
9 0.33
10 0.3
11 0.31
12 0.3
13 0.27
14 0.29
15 0.26
16 0.25
17 0.24
18 0.21
19 0.16
20 0.18
21 0.18
22 0.16
23 0.17
24 0.19
25 0.18
26 0.19
27 0.17
28 0.14
29 0.14
30 0.12
31 0.14
32 0.12
33 0.12
34 0.12
35 0.14
36 0.14
37 0.14
38 0.17
39 0.13
40 0.15
41 0.15
42 0.14
43 0.14
44 0.22
45 0.24
46 0.29
47 0.37
48 0.38
49 0.48
50 0.56
51 0.65
52 0.66
53 0.73
54 0.77
55 0.8
56 0.84
57 0.83
58 0.85
59 0.84
60 0.83
61 0.8
62 0.75
63 0.7
64 0.63
65 0.55
66 0.44
67 0.35
68 0.26
69 0.23
70 0.19
71 0.13
72 0.13
73 0.12
74 0.12
75 0.12
76 0.14
77 0.11
78 0.12
79 0.11
80 0.17
81 0.19
82 0.23
83 0.22
84 0.21