Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G4T4U4

Protein Details
Accession A0A2G4T4U4   
Localization Confidence Low
Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
115-134LDGCYKEAKSRKVCNKFYQNHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, nucl 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR044245  Spartan  
IPR006640  SprT-like_domain  
Gene Ontology GO:0005634  C:nucleus  
GO:0004222  F:metalloendopeptidase activity  
GO:0003697  F:single-stranded DNA binding  
GO:0006974  P:DNA damage response  
Pfam View protein in Pfam  
PF10263  SprT-like  
Amino Acid Sequences MLKLRSKKSLIETLLHETIHALHFITQVCDGYDGHSPAFHREARRINRLVKLNITVSHKDHVKQITVFWNYKTIDKQIPQSADAWCSEHQRTCGGKFIKIAEPDKKQTKVKRGPLDGCYKEAKSRKVCNKFYQN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.42
3 0.35
4 0.26
5 0.25
6 0.21
7 0.17
8 0.11
9 0.09
10 0.12
11 0.13
12 0.14
13 0.13
14 0.12
15 0.12
16 0.13
17 0.12
18 0.12
19 0.15
20 0.15
21 0.14
22 0.15
23 0.15
24 0.17
25 0.21
26 0.22
27 0.2
28 0.25
29 0.35
30 0.39
31 0.46
32 0.48
33 0.48
34 0.52
35 0.55
36 0.51
37 0.44
38 0.41
39 0.35
40 0.35
41 0.35
42 0.31
43 0.27
44 0.28
45 0.27
46 0.25
47 0.27
48 0.25
49 0.22
50 0.2
51 0.21
52 0.24
53 0.27
54 0.27
55 0.23
56 0.26
57 0.25
58 0.26
59 0.26
60 0.22
61 0.22
62 0.23
63 0.27
64 0.27
65 0.27
66 0.26
67 0.27
68 0.24
69 0.21
70 0.2
71 0.19
72 0.15
73 0.18
74 0.19
75 0.2
76 0.2
77 0.24
78 0.26
79 0.25
80 0.32
81 0.29
82 0.3
83 0.3
84 0.33
85 0.33
86 0.36
87 0.4
88 0.39
89 0.43
90 0.49
91 0.54
92 0.56
93 0.58
94 0.6
95 0.66
96 0.69
97 0.72
98 0.75
99 0.76
100 0.76
101 0.75
102 0.77
103 0.69
104 0.63
105 0.58
106 0.5
107 0.51
108 0.52
109 0.54
110 0.52
111 0.6
112 0.67
113 0.72
114 0.78