Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G4SJ17

Protein Details
Accession A0A2G4SJ17    Localization Confidence Low Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
79-104HARIVRVRSRTERRNRLPPQRFRFQKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, nucl 8.5, cyto_nucl 6.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
PROSITE View protein in PROSITE  
PS00733  RIBOSOMAL_S26E  
Amino Acid Sequences TSKRRNNGRNQHGRGHTKFVRCINCYRCVPKDKAIKRFTIRNMVETAAIRDIQEASVYEEYAIPKLYVKLHYCVSCAIHARIVRVRSRTERRNRLPPQRFRFQK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.73
3 0.68
4 0.63
5 0.63
6 0.62
7 0.6
8 0.54
9 0.59
10 0.55
11 0.57
12 0.56
13 0.56
14 0.55
15 0.54
16 0.55
17 0.55
18 0.61
19 0.6
20 0.65
21 0.62
22 0.63
23 0.6
24 0.63
25 0.59
26 0.59
27 0.52
28 0.44
29 0.42
30 0.35
31 0.33
32 0.26
33 0.23
34 0.14
35 0.13
36 0.11
37 0.1
38 0.09
39 0.07
40 0.07
41 0.06
42 0.08
43 0.08
44 0.08
45 0.08
46 0.09
47 0.1
48 0.1
49 0.1
50 0.07
51 0.08
52 0.09
53 0.11
54 0.15
55 0.17
56 0.2
57 0.23
58 0.24
59 0.24
60 0.25
61 0.24
62 0.23
63 0.24
64 0.22
65 0.23
66 0.23
67 0.26
68 0.29
69 0.32
70 0.33
71 0.33
72 0.39
73 0.44
74 0.52
75 0.59
76 0.65
77 0.72
78 0.75
79 0.82
80 0.86
81 0.87
82 0.88
83 0.89
84 0.86