Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G4SYN3

Protein Details
Accession A0A2G4SYN3   
Localization Confidence High
Confidence Score 15.7
NoLS Segment(s)
PositionSequenceProtein Nature
120-176KYTDPHVRRSDKKRKRDPILVNDDPLEYIDNKLKRKEKRREGRREERKREKEKSGSSBasic
NLS Segment(s)
PositionSequence
131-134KKRK
151-197KLKRKEKRREGRREERKREKEKSGSSIEQLRAKRLEREREERERAKR
Subcellular Location(s) nucl 22, cyto_nucl 13.5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR019339  CIR_N_dom  
IPR039875  LENG1-like  
Pfam View protein in Pfam  
PF10197  Cir_N  
Amino Acid Sequences MNILHHKSYHVYNKKNIEKVRKDEEAAAAKEKEKQKRIELAESEARLELLRKRANEQDKTETPIEHVNLFKDYMITNEEHDAEEKAKEEKANRQVTMYLDKGVTEEATPWYAKSHQAMNKYTDPHVRRSDKKRKRDPILVNDDPLEYIDNKLKRKEKRREGRREERKREKEKSGSSIEQLRAKRLEREREERERAKRLYLGAVEEEEQEKEEPVGYNSQYNKQETILAKQSKRRRF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.76
3 0.76
4 0.76
5 0.76
6 0.76
7 0.76
8 0.71
9 0.65
10 0.6
11 0.6
12 0.56
13 0.5
14 0.47
15 0.41
16 0.38
17 0.43
18 0.47
19 0.48
20 0.48
21 0.51
22 0.53
23 0.6
24 0.64
25 0.65
26 0.6
27 0.57
28 0.57
29 0.52
30 0.46
31 0.37
32 0.32
33 0.23
34 0.23
35 0.2
36 0.22
37 0.26
38 0.26
39 0.3
40 0.39
41 0.47
42 0.52
43 0.53
44 0.53
45 0.52
46 0.56
47 0.53
48 0.45
49 0.38
50 0.36
51 0.31
52 0.25
53 0.23
54 0.19
55 0.19
56 0.19
57 0.17
58 0.13
59 0.12
60 0.11
61 0.12
62 0.11
63 0.11
64 0.12
65 0.13
66 0.12
67 0.13
68 0.13
69 0.12
70 0.12
71 0.12
72 0.11
73 0.12
74 0.14
75 0.16
76 0.23
77 0.31
78 0.36
79 0.35
80 0.35
81 0.35
82 0.35
83 0.37
84 0.3
85 0.22
86 0.16
87 0.16
88 0.15
89 0.14
90 0.12
91 0.07
92 0.07
93 0.06
94 0.08
95 0.08
96 0.08
97 0.09
98 0.1
99 0.11
100 0.12
101 0.17
102 0.19
103 0.25
104 0.27
105 0.31
106 0.33
107 0.34
108 0.34
109 0.35
110 0.33
111 0.34
112 0.4
113 0.41
114 0.46
115 0.54
116 0.64
117 0.66
118 0.74
119 0.79
120 0.8
121 0.82
122 0.83
123 0.81
124 0.8
125 0.8
126 0.71
127 0.62
128 0.53
129 0.46
130 0.36
131 0.28
132 0.19
133 0.1
134 0.1
135 0.14
136 0.18
137 0.2
138 0.27
139 0.34
140 0.42
141 0.52
142 0.62
143 0.67
144 0.74
145 0.82
146 0.87
147 0.9
148 0.92
149 0.93
150 0.93
151 0.93
152 0.93
153 0.93
154 0.91
155 0.88
156 0.85
157 0.83
158 0.78
159 0.74
160 0.7
161 0.62
162 0.56
163 0.56
164 0.51
165 0.48
166 0.43
167 0.41
168 0.39
169 0.38
170 0.44
171 0.45
172 0.51
173 0.52
174 0.6
175 0.64
176 0.69
177 0.76
178 0.75
179 0.75
180 0.74
181 0.68
182 0.63
183 0.58
184 0.5
185 0.47
186 0.41
187 0.36
188 0.29
189 0.29
190 0.25
191 0.24
192 0.23
193 0.17
194 0.17
195 0.15
196 0.13
197 0.12
198 0.13
199 0.13
200 0.14
201 0.18
202 0.18
203 0.24
204 0.27
205 0.34
206 0.38
207 0.39
208 0.39
209 0.35
210 0.4
211 0.37
212 0.41
213 0.43
214 0.46
215 0.49
216 0.57