Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G4T8U9

Protein Details
Accession A0A2G4T8U9   
Localization Confidence Low
Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
5-30GTIIKSISKSIRRRNKKQATSGNGKDHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, cyto 4.5, cyto_nucl 4.5, nucl 3.5
Family & Domain DBs
Amino Acid Sequences MKALGTIIKSISKSIRRRNKKQATSGNGKDDAVAEVVQGSSNESRLLISEPMSISVVDEKSTFDFNSSFQFTVDGPQRHLLGKRLDDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.59
3 0.66
4 0.75
5 0.83
6 0.87
7 0.86
8 0.88
9 0.87
10 0.84
11 0.84
12 0.79
13 0.74
14 0.64
15 0.55
16 0.45
17 0.36
18 0.28
19 0.19
20 0.14
21 0.08
22 0.06
23 0.06
24 0.06
25 0.06
26 0.07
27 0.06
28 0.06
29 0.06
30 0.06
31 0.06
32 0.07
33 0.08
34 0.07
35 0.08
36 0.09
37 0.09
38 0.1
39 0.1
40 0.1
41 0.08
42 0.11
43 0.1
44 0.09
45 0.09
46 0.1
47 0.11
48 0.13
49 0.12
50 0.11
51 0.11
52 0.12
53 0.17
54 0.19
55 0.18
56 0.16
57 0.17
58 0.16
59 0.22
60 0.29
61 0.26
62 0.26
63 0.29
64 0.3
65 0.33
66 0.36
67 0.35
68 0.35