Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G4SQQ5

Protein Details
Accession A0A2G4SQQ5    Localization Confidence Low Confidence Score 5.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MRNPIKPKSRTRRFVELQDDHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 12, mito 6, extr 2, pero 2, E.R. 2, nucl 1, golg 1, vacu 1, cyto_pero 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR044234  TMEM230  
IPR008590  TMEM_230/134  
Gene Ontology GO:0005776  C:autophagosome  
GO:0005769  C:early endosome  
GO:0005794  C:Golgi apparatus  
GO:0005770  C:late endosome  
GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF05915  TMEM_230_134  
Amino Acid Sequences MRNPIKPKSRTRRFVELQDDTGFTSAQFENQDPPIPWNAIGLAILLFLAGGGLLAVGILIKIGQITSEEWLSRGIPFIVLGSIMFIPGAYHLYIAYYAYYKYPGYDFSLIPDWD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.79
3 0.72
4 0.65
5 0.58
6 0.51
7 0.41
8 0.36
9 0.27
10 0.17
11 0.16
12 0.12
13 0.12
14 0.13
15 0.13
16 0.16
17 0.17
18 0.2
19 0.17
20 0.19
21 0.2
22 0.19
23 0.18
24 0.15
25 0.14
26 0.11
27 0.11
28 0.08
29 0.05
30 0.04
31 0.04
32 0.03
33 0.03
34 0.02
35 0.02
36 0.02
37 0.01
38 0.01
39 0.01
40 0.01
41 0.01
42 0.01
43 0.01
44 0.01
45 0.01
46 0.01
47 0.01
48 0.02
49 0.02
50 0.02
51 0.03
52 0.04
53 0.05
54 0.07
55 0.07
56 0.07
57 0.09
58 0.09
59 0.08
60 0.09
61 0.08
62 0.07
63 0.07
64 0.07
65 0.06
66 0.06
67 0.05
68 0.06
69 0.05
70 0.05
71 0.05
72 0.04
73 0.04
74 0.05
75 0.07
76 0.05
77 0.06
78 0.06
79 0.07
80 0.07
81 0.07
82 0.08
83 0.07
84 0.08
85 0.09
86 0.12
87 0.11
88 0.12
89 0.13
90 0.15
91 0.2
92 0.23
93 0.22
94 0.24