Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G4SP84

Protein Details
Accession A0A2G4SP84   
Localization Confidence Medium
Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
55-86ILLNGGKKYNRSRRKNTKRNRKKKEESTKVCEHydrophilic
NLS Segment(s)
PositionSequence
61-78KKYNRSRRKNTKRNRKKK
Subcellular Location(s) mito 14, nucl 12.5, cyto_nucl 7
Family & Domain DBs
Amino Acid Sequences MPASKTASIQRHMTYLNYILRHVDILLNFYNFETAKLKWLNYVGSQKVIQESVNILLNGGKKYNRSRRKNTKRNRKKKEESTKVCE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.29
3 0.3
4 0.26
5 0.25
6 0.23
7 0.23
8 0.22
9 0.19
10 0.16
11 0.11
12 0.13
13 0.14
14 0.13
15 0.13
16 0.12
17 0.14
18 0.11
19 0.13
20 0.12
21 0.11
22 0.16
23 0.17
24 0.17
25 0.17
26 0.18
27 0.17
28 0.19
29 0.23
30 0.18
31 0.19
32 0.19
33 0.18
34 0.18
35 0.17
36 0.14
37 0.1
38 0.1
39 0.1
40 0.12
41 0.11
42 0.1
43 0.12
44 0.14
45 0.14
46 0.16
47 0.15
48 0.18
49 0.28
50 0.39
51 0.47
52 0.54
53 0.64
54 0.74
55 0.84
56 0.9
57 0.91
58 0.92
59 0.93
60 0.96
61 0.96
62 0.95
63 0.95
64 0.95
65 0.96
66 0.95