Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E2LWZ6

Protein Details
Accession E2LWZ6    Localization Confidence Low Confidence Score 5.8
NoLS Segment(s)
PositionSequenceProtein Nature
197-222SSDSMKKENKDTKKEHKPRESPLHWFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, cyto 9, extr 4, nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR018712  DUF2235  
KEGG mpr:MPER_11791  -  
Pfam View protein in Pfam  
PF09994  DUF2235  
Amino Acid Sequences AGIGTYTSPRVATPLMSKVVKTVVEMVALHLDAHVMDGYEFLMQNYVAGDRICIFGFSRGAYTARSLAGMIHKVGLLPADNWQQVPFAYKMYTRTDQVGWEQSNAFKEAFSIDVTIDFVGVWDTVDSVGLVPKRLPFTTSNTILRTFRHAVSLDERRAKFKANLWNRPTAKEAVLGGGRSVTHSPLNHSSHDSPRSSSDSMKKENKDTKKEHKPRESPLHWFDEDERDLADNEGRYSAHIANG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.29
3 0.29
4 0.29
5 0.28
6 0.31
7 0.29
8 0.25
9 0.24
10 0.19
11 0.2
12 0.2
13 0.2
14 0.18
15 0.17
16 0.16
17 0.11
18 0.1
19 0.08
20 0.09
21 0.07
22 0.05
23 0.05
24 0.05
25 0.06
26 0.07
27 0.07
28 0.06
29 0.07
30 0.07
31 0.07
32 0.07
33 0.07
34 0.07
35 0.07
36 0.08
37 0.08
38 0.1
39 0.09
40 0.1
41 0.1
42 0.11
43 0.12
44 0.12
45 0.13
46 0.13
47 0.13
48 0.13
49 0.14
50 0.13
51 0.12
52 0.12
53 0.11
54 0.11
55 0.14
56 0.15
57 0.13
58 0.12
59 0.12
60 0.11
61 0.11
62 0.1
63 0.08
64 0.07
65 0.1
66 0.14
67 0.14
68 0.14
69 0.15
70 0.14
71 0.14
72 0.17
73 0.13
74 0.1
75 0.11
76 0.12
77 0.16
78 0.21
79 0.23
80 0.21
81 0.23
82 0.22
83 0.22
84 0.24
85 0.26
86 0.21
87 0.2
88 0.2
89 0.19
90 0.19
91 0.19
92 0.17
93 0.1
94 0.1
95 0.09
96 0.09
97 0.08
98 0.07
99 0.06
100 0.06
101 0.07
102 0.06
103 0.06
104 0.04
105 0.04
106 0.04
107 0.04
108 0.03
109 0.03
110 0.03
111 0.03
112 0.03
113 0.03
114 0.03
115 0.05
116 0.06
117 0.06
118 0.07
119 0.09
120 0.11
121 0.11
122 0.14
123 0.14
124 0.21
125 0.27
126 0.3
127 0.31
128 0.31
129 0.33
130 0.32
131 0.3
132 0.29
133 0.26
134 0.22
135 0.23
136 0.22
137 0.21
138 0.27
139 0.33
140 0.32
141 0.37
142 0.37
143 0.37
144 0.37
145 0.39
146 0.35
147 0.34
148 0.4
149 0.42
150 0.51
151 0.52
152 0.61
153 0.59
154 0.58
155 0.55
156 0.47
157 0.38
158 0.31
159 0.28
160 0.21
161 0.21
162 0.19
163 0.15
164 0.14
165 0.13
166 0.12
167 0.13
168 0.11
169 0.14
170 0.14
171 0.2
172 0.27
173 0.29
174 0.29
175 0.34
176 0.36
177 0.4
178 0.45
179 0.41
180 0.36
181 0.37
182 0.41
183 0.37
184 0.39
185 0.4
186 0.41
187 0.48
188 0.55
189 0.55
190 0.59
191 0.67
192 0.7
193 0.71
194 0.73
195 0.75
196 0.78
197 0.85
198 0.86
199 0.87
200 0.85
201 0.86
202 0.88
203 0.82
204 0.79
205 0.75
206 0.72
207 0.62
208 0.57
209 0.5
210 0.47
211 0.43
212 0.35
213 0.3
214 0.24
215 0.24
216 0.23
217 0.23
218 0.16
219 0.16
220 0.17
221 0.16
222 0.16
223 0.2