Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2G4SGH8

Protein Details
Accession A0A2G4SGH8    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
55-85DTEVIQKRRPFRRPSRRPYRRPRPAPAPTAPHydrophilic
NLS Segment(s)
PositionSequence
61-89KRRPFRRPSRRPYRRPRPAPAPTAPTGPK
Subcellular Location(s) extr 24, mito 1, plas 1, vacu 1
Family & Domain DBs
Amino Acid Sequences MQIKIVILTICASLAAIGFASPASQNPDSLIPGSNLASDTNGTGLLVPGANDSGDTEVIQKRRPFRRPSRRPYRRPRPAPAPTAPTGPKAPEGPAGPTEPAPPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.05
3 0.04
4 0.04
5 0.04
6 0.04
7 0.05
8 0.05
9 0.06
10 0.12
11 0.12
12 0.13
13 0.14
14 0.16
15 0.16
16 0.17
17 0.17
18 0.11
19 0.12
20 0.13
21 0.11
22 0.1
23 0.09
24 0.09
25 0.08
26 0.08
27 0.07
28 0.06
29 0.06
30 0.05
31 0.05
32 0.04
33 0.04
34 0.04
35 0.04
36 0.04
37 0.04
38 0.04
39 0.04
40 0.04
41 0.05
42 0.05
43 0.07
44 0.1
45 0.11
46 0.16
47 0.19
48 0.26
49 0.34
50 0.42
51 0.5
52 0.58
53 0.68
54 0.74
55 0.82
56 0.86
57 0.89
58 0.91
59 0.93
60 0.94
61 0.93
62 0.91
63 0.89
64 0.88
65 0.85
66 0.81
67 0.76
68 0.71
69 0.62
70 0.6
71 0.53
72 0.46
73 0.41
74 0.35
75 0.33
76 0.27
77 0.28
78 0.27
79 0.27
80 0.27
81 0.28
82 0.29
83 0.27
84 0.27