Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J0WL40

Protein Details
Accession J0WL40    Localization Confidence High Confidence Score 23.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-44KLDKKRKAAGKDKAPKKARAPKKDKGPPKKKSLKGKEKASTPEEBasic
100-124PADPTPPPPEKKRRKGKKADLDAVABasic
148-170EEPGTSKRRSDRKKKNDKEAAPEBasic
NLS Segment(s)
PositionSequence
4-38KKRKAAGKDKAPKKARAPKKDKGPPKKKSLKGKEK
92-119PKKPSAPPPADPTPPPPEKKRRKGKKAD
154-163KRRSDRKKKN
Subcellular Location(s) nucl 23.5, cyto_nucl 13.5
Family & Domain DBs
KEGG adl:AURDEDRAFT_132125  -  
Amino Acid Sequences KLDKKRKAAGKDKAPKKARAPKKDKGPPKKKSLKGKEKASTPEERVTPEEEDGVVPPPPPPPVQPVPPLPLPNPPKAPLEVEPNPPVPPLSPKKPSAPPPADPTPPPPEKKRRKGKKADLDAVAKPAAEAEASSRGQKRKAADVDDVEEPGTSKRRSDRKKKNDKEAAPEAEDNDDNNETDERPSEYEGPFASDKDIAKLTADETPLEPKSSIMVKLGDKSDQFVGITLPDALCDKKHHFAWAFKRAMEGIPMVENDAKLLKFALCVWPKPKVMRKEMKEAAIEAITLF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.83
3 0.83
4 0.84
5 0.83
6 0.84
7 0.83
8 0.82
9 0.86
10 0.88
11 0.89
12 0.89
13 0.89
14 0.87
15 0.89
16 0.91
17 0.88
18 0.89
19 0.9
20 0.9
21 0.88
22 0.9
23 0.86
24 0.83
25 0.82
26 0.76
27 0.73
28 0.67
29 0.63
30 0.55
31 0.51
32 0.46
33 0.42
34 0.38
35 0.31
36 0.27
37 0.21
38 0.19
39 0.17
40 0.16
41 0.14
42 0.12
43 0.12
44 0.12
45 0.14
46 0.15
47 0.16
48 0.21
49 0.26
50 0.3
51 0.34
52 0.37
53 0.4
54 0.42
55 0.43
56 0.37
57 0.41
58 0.41
59 0.42
60 0.42
61 0.39
62 0.38
63 0.37
64 0.39
65 0.33
66 0.36
67 0.35
68 0.36
69 0.37
70 0.36
71 0.34
72 0.31
73 0.28
74 0.21
75 0.25
76 0.27
77 0.31
78 0.35
79 0.37
80 0.43
81 0.5
82 0.56
83 0.58
84 0.57
85 0.53
86 0.55
87 0.57
88 0.53
89 0.48
90 0.46
91 0.43
92 0.44
93 0.45
94 0.46
95 0.52
96 0.6
97 0.69
98 0.74
99 0.77
100 0.82
101 0.89
102 0.91
103 0.91
104 0.89
105 0.86
106 0.8
107 0.73
108 0.63
109 0.54
110 0.43
111 0.32
112 0.23
113 0.16
114 0.11
115 0.06
116 0.06
117 0.05
118 0.1
119 0.1
120 0.13
121 0.17
122 0.19
123 0.21
124 0.24
125 0.24
126 0.27
127 0.3
128 0.31
129 0.3
130 0.3
131 0.3
132 0.28
133 0.26
134 0.18
135 0.15
136 0.12
137 0.1
138 0.13
139 0.11
140 0.12
141 0.19
142 0.28
143 0.38
144 0.49
145 0.59
146 0.66
147 0.77
148 0.83
149 0.87
150 0.87
151 0.82
152 0.79
153 0.75
154 0.68
155 0.59
156 0.52
157 0.42
158 0.34
159 0.3
160 0.22
161 0.17
162 0.14
163 0.11
164 0.11
165 0.11
166 0.1
167 0.1
168 0.11
169 0.1
170 0.11
171 0.13
172 0.15
173 0.14
174 0.16
175 0.15
176 0.18
177 0.17
178 0.16
179 0.15
180 0.15
181 0.15
182 0.16
183 0.16
184 0.13
185 0.13
186 0.13
187 0.13
188 0.13
189 0.14
190 0.12
191 0.13
192 0.17
193 0.17
194 0.18
195 0.17
196 0.14
197 0.16
198 0.18
199 0.17
200 0.15
201 0.17
202 0.18
203 0.22
204 0.23
205 0.23
206 0.21
207 0.23
208 0.22
209 0.19
210 0.18
211 0.14
212 0.13
213 0.1
214 0.11
215 0.09
216 0.08
217 0.08
218 0.09
219 0.09
220 0.11
221 0.16
222 0.19
223 0.24
224 0.26
225 0.32
226 0.35
227 0.43
228 0.51
229 0.56
230 0.54
231 0.48
232 0.49
233 0.43
234 0.39
235 0.33
236 0.25
237 0.16
238 0.16
239 0.16
240 0.16
241 0.17
242 0.15
243 0.14
244 0.17
245 0.15
246 0.13
247 0.14
248 0.12
249 0.12
250 0.14
251 0.22
252 0.24
253 0.3
254 0.33
255 0.39
256 0.44
257 0.52
258 0.59
259 0.59
260 0.65
261 0.7
262 0.72
263 0.75
264 0.77
265 0.73
266 0.67
267 0.59
268 0.52
269 0.42