Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G4TAB7

Protein Details
Accession A0A2G4TAB7   
Localization Confidence Medium
Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
96-121DNDSIKKSKNIHRKSKHTHQCCSQHKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, mito 9, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR008011  Complex1_LYR_dom  
IPR045298  Complex1_LYR_LYRM7  
Gene Ontology GO:0005759  C:mitochondrial matrix  
GO:0034551  P:mitochondrial respiratory chain complex III assembly  
Pfam View protein in Pfam  
PF05347  Complex1_LYR  
CDD cd20267  Complex1_LYR_LYRM7  
Amino Acid Sequences MSLQPSKQAVLQAYRSLLRTQKQVFDTDYRAIEAARKETYARFMQFKDETNTDILEEKLQLARQVDVLLRKNVIQGVNQGNNTFKLRITKDTELGDNDSIKKSKNIHRKSKHTHQCCSQHK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.32
3 0.32
4 0.33
5 0.31
6 0.35
7 0.36
8 0.39
9 0.39
10 0.4
11 0.41
12 0.4
13 0.4
14 0.36
15 0.33
16 0.27
17 0.25
18 0.22
19 0.22
20 0.19
21 0.19
22 0.16
23 0.16
24 0.17
25 0.18
26 0.23
27 0.23
28 0.24
29 0.24
30 0.23
31 0.28
32 0.29
33 0.31
34 0.3
35 0.26
36 0.25
37 0.23
38 0.22
39 0.17
40 0.16
41 0.13
42 0.1
43 0.09
44 0.08
45 0.08
46 0.08
47 0.09
48 0.09
49 0.09
50 0.08
51 0.09
52 0.1
53 0.14
54 0.16
55 0.16
56 0.16
57 0.16
58 0.16
59 0.18
60 0.17
61 0.13
62 0.16
63 0.21
64 0.24
65 0.25
66 0.25
67 0.23
68 0.25
69 0.26
70 0.22
71 0.17
72 0.2
73 0.22
74 0.27
75 0.33
76 0.34
77 0.36
78 0.38
79 0.39
80 0.35
81 0.36
82 0.32
83 0.27
84 0.26
85 0.26
86 0.25
87 0.24
88 0.26
89 0.3
90 0.37
91 0.46
92 0.54
93 0.61
94 0.7
95 0.79
96 0.84
97 0.88
98 0.9
99 0.87
100 0.86
101 0.85