Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2G4T419

Protein Details
Accession A0A2G4T419    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
12-45KVKSQTPKVAKQEKKKPKTGRAKKRQIYNRRFVNHydrophilic
NLS Segment(s)
PositionSequence
10-36AGKVKSQTPKVAKQEKKKPKTGRAKKR
Subcellular Location(s) nucl 13, mito 9, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences GKVHGSLARAGKVKSQTPKVAKQEKKKPKTGRAKKRQIYNRRFVNVTTQIGGKRRMNPAPTQGP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.46
3 0.49
4 0.52
5 0.61
6 0.64
7 0.7
8 0.71
9 0.73
10 0.77
11 0.8
12 0.81
13 0.81
14 0.8
15 0.8
16 0.84
17 0.85
18 0.85
19 0.85
20 0.88
21 0.84
22 0.85
23 0.85
24 0.85
25 0.83
26 0.81
27 0.78
28 0.71
29 0.67
30 0.58
31 0.56
32 0.51
33 0.45
34 0.37
35 0.31
36 0.31
37 0.34
38 0.4
39 0.36
40 0.36
41 0.41
42 0.47
43 0.48
44 0.5