Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G4SPQ9

Protein Details
Accession A0A2G4SPQ9   
Localization Confidence Medium
Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MRVSNPTSKRRNNGRNQHGRGHTKFHydrophilic
85-113HARIVRVRSRTQRRSRLPPPRFRFQKTANHydrophilic
NLS Segment(s)
PositionSequence
96-105QRRSRLPPPR
Subcellular Location(s) nucl 12, mito 9, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
PROSITE View protein in PROSITE  
PS00733  RIBOSOMAL_S26E  
Amino Acid Sequences MRVSNPTSKRRNNGRNQHGRGHTKFVRCINCYRCVPKDKAIKRFTIRNMVETAAIRDIQEASVYEEYAIPKLYVKLHYCVSCAIHARIVRVRSRTQRRSRLPPPRFRFQKTANKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.88
3 0.86
4 0.85
5 0.83
6 0.81
7 0.74
8 0.72
9 0.67
10 0.61
11 0.61
12 0.6
13 0.58
14 0.52
15 0.58
16 0.53
17 0.55
18 0.54
19 0.54
20 0.53
21 0.53
22 0.54
23 0.53
24 0.59
25 0.58
26 0.63
27 0.61
28 0.62
29 0.59
30 0.62
31 0.58
32 0.58
33 0.51
34 0.43
35 0.41
36 0.35
37 0.32
38 0.25
39 0.23
40 0.13
41 0.13
42 0.11
43 0.09
44 0.09
45 0.07
46 0.07
47 0.06
48 0.08
49 0.08
50 0.08
51 0.08
52 0.09
53 0.1
54 0.1
55 0.1
56 0.07
57 0.07
58 0.09
59 0.11
60 0.15
61 0.17
62 0.19
63 0.23
64 0.24
65 0.24
66 0.24
67 0.23
68 0.22
69 0.23
70 0.21
71 0.22
72 0.22
73 0.25
74 0.28
75 0.3
76 0.32
77 0.33
78 0.4
79 0.46
80 0.56
81 0.63
82 0.68
83 0.75
84 0.79
85 0.84
86 0.87
87 0.88
88 0.87
89 0.88
90 0.85
91 0.86
92 0.85
93 0.82
94 0.8
95 0.79