Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2G4SH90

Protein Details
Accession A0A2G4SH90    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
40-72PRNIKTRLIRLKRLNRKKKRIRRQIMSKNKFDVHydrophilic
NLS Segment(s)
PositionSequence
40-63PRNIKTRLIRLKRLNRKKKRIRRQ
Subcellular Location(s) plas 12, mito 7, E.R. 4, nucl 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MLLPVTSHLCLQSVKIRVFKLYYLLLFLPLAVLLLPLRAPRNIKTRLIRLKRLNRKKKRIRRQIMSKNKFDVLLVMELITLALPASCVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.31
3 0.32
4 0.33
5 0.34
6 0.32
7 0.29
8 0.25
9 0.22
10 0.2
11 0.19
12 0.17
13 0.16
14 0.14
15 0.11
16 0.08
17 0.07
18 0.04
19 0.04
20 0.03
21 0.04
22 0.04
23 0.06
24 0.07
25 0.09
26 0.11
27 0.15
28 0.23
29 0.26
30 0.32
31 0.34
32 0.41
33 0.5
34 0.53
35 0.58
36 0.6
37 0.66
38 0.72
39 0.79
40 0.82
41 0.83
42 0.88
43 0.91
44 0.93
45 0.93
46 0.94
47 0.93
48 0.93
49 0.93
50 0.93
51 0.93
52 0.9
53 0.85
54 0.78
55 0.68
56 0.58
57 0.47
58 0.38
59 0.29
60 0.23
61 0.18
62 0.13
63 0.12
64 0.11
65 0.11
66 0.08
67 0.05
68 0.03
69 0.03