Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G4SZR1

Protein Details
Accession A0A2G4SZR1   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
97-121FYGIVRTNLKKRKLRRIVVKTISNDHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 17, E.R. 4, mito 3, vacu 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR006634  TLC-dom  
Gene Ontology GO:0016020  C:membrane  
PROSITE View protein in PROSITE  
PS50922  TLC  
Amino Acid Sequences MTGWVHHLFYIAVLFWFLRLQISSLFTVASILELPTVILAIGSMDHELRSDLLFGSTFFLLRLVAHAWMTIALKRHHRIKVMWVIALVIYPLHLYWFYGIVRTNLKKRKLRRIVVKTISNDVF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.07
3 0.08
4 0.07
5 0.08
6 0.08
7 0.09
8 0.1
9 0.13
10 0.13
11 0.13
12 0.13
13 0.11
14 0.11
15 0.1
16 0.08
17 0.06
18 0.05
19 0.05
20 0.05
21 0.05
22 0.04
23 0.04
24 0.03
25 0.03
26 0.02
27 0.02
28 0.03
29 0.03
30 0.04
31 0.04
32 0.04
33 0.05
34 0.05
35 0.06
36 0.06
37 0.06
38 0.05
39 0.06
40 0.06
41 0.06
42 0.07
43 0.07
44 0.07
45 0.06
46 0.06
47 0.06
48 0.05
49 0.06
50 0.05
51 0.06
52 0.06
53 0.06
54 0.05
55 0.06
56 0.07
57 0.08
58 0.11
59 0.13
60 0.18
61 0.23
62 0.29
63 0.32
64 0.34
65 0.34
66 0.38
67 0.45
68 0.41
69 0.38
70 0.31
71 0.28
72 0.25
73 0.23
74 0.16
75 0.06
76 0.05
77 0.04
78 0.04
79 0.05
80 0.05
81 0.05
82 0.06
83 0.09
84 0.09
85 0.11
86 0.12
87 0.14
88 0.22
89 0.27
90 0.36
91 0.41
92 0.51
93 0.57
94 0.65
95 0.73
96 0.76
97 0.81
98 0.83
99 0.84
100 0.86
101 0.87
102 0.86
103 0.78