Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2G4SKG7

Protein Details
Accession A0A2G4SKG7    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
97-131GLAEPPKGGRKQRKEKKNREKKFRGVRKTKKVRKEBasic
NLS Segment(s)
PositionSequence
101-131PPKGGRKQRKEKKNREKKFRGVRKTKKVRKE
Subcellular Location(s) mito 20, cyto 5.5, cyto_nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences MADASSVTIRTRKFLTNRLLQRKQMVVDVIHPGLANVSKDELRAKIAKMYKAEKEVVSVFGFKTHFGGGKTTGFALIYDNLEALKKFEPRYRLVRYGLAEPPKGGRKQRKEKKNREKKFRGVRKTKKVRKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.46
3 0.52
4 0.62
5 0.69
6 0.72
7 0.68
8 0.68
9 0.63
10 0.57
11 0.5
12 0.42
13 0.32
14 0.29
15 0.29
16 0.24
17 0.21
18 0.19
19 0.15
20 0.14
21 0.15
22 0.12
23 0.08
24 0.1
25 0.1
26 0.11
27 0.14
28 0.13
29 0.15
30 0.17
31 0.17
32 0.21
33 0.25
34 0.28
35 0.3
36 0.33
37 0.33
38 0.35
39 0.36
40 0.29
41 0.28
42 0.25
43 0.23
44 0.19
45 0.17
46 0.13
47 0.14
48 0.14
49 0.11
50 0.12
51 0.1
52 0.11
53 0.1
54 0.12
55 0.11
56 0.12
57 0.12
58 0.11
59 0.1
60 0.09
61 0.08
62 0.08
63 0.08
64 0.07
65 0.07
66 0.07
67 0.07
68 0.07
69 0.07
70 0.08
71 0.1
72 0.13
73 0.15
74 0.19
75 0.23
76 0.27
77 0.35
78 0.4
79 0.42
80 0.42
81 0.44
82 0.43
83 0.44
84 0.45
85 0.42
86 0.36
87 0.31
88 0.34
89 0.36
90 0.39
91 0.43
92 0.48
93 0.54
94 0.64
95 0.74
96 0.8
97 0.84
98 0.91
99 0.93
100 0.94
101 0.94
102 0.94
103 0.94
104 0.93
105 0.93
106 0.93
107 0.92
108 0.92
109 0.93
110 0.93
111 0.94