Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2G4T229

Protein Details
Accession A0A2G4T229    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
44-72EEQVSEKKTKKVKKLKTKKPEETKTDSKQBasic
NLS Segment(s)
PositionSequence
37-64GEKKRRSEEQVSEKKTKKVKKLKTKKPE
Subcellular Location(s) nucl 23, cyto_nucl 13.333, mito_nucl 12.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR019327  WKF  
Pfam View protein in Pfam  
PF10180  WKF  
Amino Acid Sequences MTAKKAAKEALLKGVKSTHVSFDDEGNEQKVETVTKGEKKRRSEEQVSEKKTKKVKKLKTKKPEETKTDSKQKEAFEYLRLFVNDRKNWKFKKVLQTWILQSLYKMPKSEFDNALEYLKDLQGASREKTKKEAQDRIPKNSIGNNLTGYTNVSNDDFDDFDAEKLLAQVSVTQSSTKQDESEEVRRARLIVDTLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.38
3 0.37
4 0.35
5 0.31
6 0.28
7 0.31
8 0.3
9 0.3
10 0.3
11 0.27
12 0.28
13 0.24
14 0.21
15 0.18
16 0.18
17 0.16
18 0.14
19 0.13
20 0.16
21 0.2
22 0.28
23 0.37
24 0.45
25 0.52
26 0.57
27 0.64
28 0.68
29 0.71
30 0.71
31 0.71
32 0.74
33 0.76
34 0.76
35 0.78
36 0.73
37 0.7
38 0.7
39 0.68
40 0.68
41 0.68
42 0.72
43 0.75
44 0.82
45 0.86
46 0.89
47 0.92
48 0.92
49 0.92
50 0.9
51 0.86
52 0.84
53 0.82
54 0.79
55 0.79
56 0.69
57 0.63
58 0.58
59 0.52
60 0.47
61 0.43
62 0.36
63 0.3
64 0.31
65 0.27
66 0.26
67 0.24
68 0.22
69 0.22
70 0.3
71 0.29
72 0.34
73 0.38
74 0.43
75 0.45
76 0.49
77 0.52
78 0.49
79 0.56
80 0.55
81 0.57
82 0.53
83 0.54
84 0.49
85 0.47
86 0.42
87 0.31
88 0.25
89 0.25
90 0.25
91 0.23
92 0.23
93 0.18
94 0.22
95 0.26
96 0.31
97 0.26
98 0.24
99 0.26
100 0.26
101 0.26
102 0.22
103 0.18
104 0.14
105 0.12
106 0.1
107 0.07
108 0.07
109 0.12
110 0.15
111 0.16
112 0.24
113 0.27
114 0.27
115 0.33
116 0.38
117 0.42
118 0.48
119 0.55
120 0.56
121 0.64
122 0.68
123 0.7
124 0.69
125 0.61
126 0.54
127 0.49
128 0.46
129 0.37
130 0.33
131 0.27
132 0.25
133 0.24
134 0.22
135 0.2
136 0.15
137 0.13
138 0.13
139 0.12
140 0.11
141 0.11
142 0.13
143 0.11
144 0.1
145 0.12
146 0.12
147 0.11
148 0.12
149 0.11
150 0.1
151 0.1
152 0.1
153 0.07
154 0.06
155 0.09
156 0.11
157 0.14
158 0.14
159 0.15
160 0.16
161 0.2
162 0.23
163 0.21
164 0.19
165 0.18
166 0.23
167 0.29
168 0.36
169 0.41
170 0.39
171 0.4
172 0.4
173 0.39
174 0.34
175 0.3