Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G4SUD1

Protein Details
Accession A0A2G4SUD1    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
179-223HRARDCPDRRNGSHRRRRSRSRSVEKRSRSRSERRSRSDSPARRSBasic
NLS Segment(s)
PositionSequence
187-229RRNGSHRRRRSRSRSVEKRSRSRSERRSRSDSPARRSRSRSPP
Subcellular Location(s) nucl 24.5, cyto_nucl 15
Family & Domain DBs
InterPro View protein in InterPro  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR035979  RBD_domain_sf  
IPR000504  RRM_dom  
IPR001878  Znf_CCHC  
IPR036875  Znf_CCHC_sf  
Gene Ontology GO:0003723  F:RNA binding  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00076  RRM_1  
PF00098  zf-CCHC  
PROSITE View protein in PROSITE  
PS50102  RRM  
PS50158  ZF_CCHC  
Amino Acid Sequences MSHYDRERDYDSSRPRDIDKPNPCRLYVGNVSRYVREKDLRNLFSRYGRIRDLILRNFYAFVEYDDVRDAEDATKELNGYKLEGERIVVHVANVARSRLNRTRDREDRDRDSRRRDDSRERDHDYRSSRKGGDSNDPDRCYNCGEFGNSANECSLPKGSGERAMRFQKGVCFECGETGHRARDCPDRRNGSHRRRRSRSRSVEKRSRSRSERRSRSDSPARRSRSRSPPF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.5
3 0.54
4 0.58
5 0.59
6 0.6
7 0.62
8 0.68
9 0.69
10 0.65
11 0.6
12 0.54
13 0.51
14 0.5
15 0.49
16 0.45
17 0.47
18 0.49
19 0.49
20 0.52
21 0.47
22 0.44
23 0.42
24 0.41
25 0.45
26 0.53
27 0.54
28 0.54
29 0.54
30 0.51
31 0.51
32 0.53
33 0.47
34 0.42
35 0.39
36 0.36
37 0.35
38 0.39
39 0.42
40 0.41
41 0.4
42 0.37
43 0.36
44 0.35
45 0.33
46 0.26
47 0.19
48 0.15
49 0.14
50 0.13
51 0.13
52 0.14
53 0.14
54 0.12
55 0.12
56 0.11
57 0.08
58 0.09
59 0.09
60 0.08
61 0.08
62 0.08
63 0.09
64 0.1
65 0.09
66 0.1
67 0.11
68 0.12
69 0.12
70 0.12
71 0.12
72 0.1
73 0.11
74 0.12
75 0.11
76 0.09
77 0.11
78 0.11
79 0.13
80 0.13
81 0.12
82 0.12
83 0.13
84 0.2
85 0.24
86 0.31
87 0.35
88 0.41
89 0.5
90 0.56
91 0.63
92 0.64
93 0.65
94 0.66
95 0.68
96 0.71
97 0.67
98 0.68
99 0.66
100 0.64
101 0.63
102 0.61
103 0.63
104 0.62
105 0.66
106 0.65
107 0.65
108 0.61
109 0.58
110 0.58
111 0.54
112 0.51
113 0.45
114 0.42
115 0.37
116 0.36
117 0.37
118 0.35
119 0.38
120 0.38
121 0.41
122 0.43
123 0.44
124 0.43
125 0.4
126 0.38
127 0.33
128 0.26
129 0.21
130 0.16
131 0.16
132 0.16
133 0.17
134 0.21
135 0.17
136 0.17
137 0.15
138 0.15
139 0.14
140 0.14
141 0.13
142 0.08
143 0.09
144 0.11
145 0.12
146 0.19
147 0.23
148 0.24
149 0.3
150 0.35
151 0.35
152 0.34
153 0.34
154 0.32
155 0.34
156 0.33
157 0.28
158 0.26
159 0.25
160 0.27
161 0.28
162 0.25
163 0.24
164 0.25
165 0.28
166 0.26
167 0.27
168 0.27
169 0.36
170 0.4
171 0.42
172 0.49
173 0.52
174 0.55
175 0.64
176 0.72
177 0.73
178 0.77
179 0.81
180 0.82
181 0.83
182 0.9
183 0.9
184 0.91
185 0.91
186 0.91
187 0.92
188 0.91
189 0.92
190 0.91
191 0.92
192 0.9
193 0.88
194 0.85
195 0.85
196 0.86
197 0.87
198 0.87
199 0.86
200 0.85
201 0.81
202 0.83
203 0.83
204 0.81
205 0.8
206 0.79
207 0.78
208 0.78
209 0.79
210 0.79