Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G4SNV9

Protein Details
Accession A0A2G4SNV9   
Localization Confidence Medium
Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MTSKRRNNGRNQHGRGHTKFHydrophilic
80-107HARIVRVRSRTERRNRLPPPRFRFQKTAHydrophilic
NLS Segment(s)
PositionSequence
91-100ERRNRLPPPR
Subcellular Location(s) mito 17, nucl 5.5, cyto_nucl 5.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
PROSITE View protein in PROSITE  
PS00733  RIBOSOMAL_S26E  
Amino Acid Sequences MTSKRRNNGRNQHGRGHTKFVRCINCYRCVPKDKAIKRFTIRNMVETAAIRDIQEASVYEEYAIPKLYVKLHYCVSCAIHARIVRVRSRTERRNRLPPPRFRFQKTANKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.75
3 0.73
4 0.68
5 0.63
6 0.63
7 0.61
8 0.6
9 0.54
10 0.59
11 0.55
12 0.57
13 0.56
14 0.56
15 0.55
16 0.54
17 0.55
18 0.55
19 0.61
20 0.6
21 0.65
22 0.62
23 0.63
24 0.6
25 0.63
26 0.59
27 0.59
28 0.52
29 0.45
30 0.42
31 0.36
32 0.33
33 0.26
34 0.23
35 0.14
36 0.13
37 0.11
38 0.1
39 0.09
40 0.08
41 0.08
42 0.06
43 0.08
44 0.08
45 0.08
46 0.08
47 0.09
48 0.09
49 0.1
50 0.1
51 0.07
52 0.07
53 0.09
54 0.11
55 0.15
56 0.17
57 0.19
58 0.22
59 0.23
60 0.23
61 0.24
62 0.23
63 0.22
64 0.23
65 0.21
66 0.22
67 0.22
68 0.25
69 0.27
70 0.3
71 0.31
72 0.32
73 0.37
74 0.42
75 0.51
76 0.57
77 0.63
78 0.7
79 0.74
80 0.81
81 0.84
82 0.86
83 0.87
84 0.87
85 0.84
86 0.84
87 0.84
88 0.8
89 0.8
90 0.78