Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G4SR40

Protein Details
Accession A0A2G4SR40   
Localization Confidence Medium
Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
198-217DESRKRQKENPRFRENDEEDAcidic
NLS Segment(s)
Subcellular Location(s) nucl 22.5, cyto_nucl 13.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027157  NCBP2  
IPR034148  NCBP2_RRM  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR035979  RBD_domain_sf  
IPR000504  RRM_dom  
Gene Ontology GO:0005846  C:nuclear cap binding complex  
GO:0005634  C:nucleus  
GO:0000339  F:RNA cap binding  
GO:0045292  P:mRNA cis splicing, via spliceosome  
Pfam View protein in Pfam  
PF00076  RRM_1  
PROSITE View protein in PROSITE  
PS50102  RRM  
CDD cd12240  RRM_NCBP2  
Amino Acid Sequences MTTIINSLAVPSSYRDQLYQGSSNQLTDDLSTTATLYVGNLSFFTTEEQIYELFSKCGEIKRIIMGLDRHQKTPCGFCFVEYYHRTDALDCMKYINGTKLDERIIRCDLDPGFREGRQFGRGKSGGQVRDEYRTEYDAGRGGWGHRMRMELERNREKNIKENYEAIKEIPKGADEYKSRSTNAQANSKRRMDDDENEDESRKRQKENPRFRENDEEDEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.2
3 0.21
4 0.25
5 0.29
6 0.3
7 0.27
8 0.31
9 0.31
10 0.3
11 0.28
12 0.25
13 0.2
14 0.16
15 0.17
16 0.1
17 0.1
18 0.1
19 0.1
20 0.1
21 0.09
22 0.08
23 0.06
24 0.08
25 0.08
26 0.08
27 0.07
28 0.08
29 0.08
30 0.09
31 0.1
32 0.1
33 0.09
34 0.09
35 0.1
36 0.1
37 0.11
38 0.12
39 0.11
40 0.1
41 0.1
42 0.11
43 0.12
44 0.16
45 0.18
46 0.18
47 0.19
48 0.21
49 0.22
50 0.21
51 0.23
52 0.22
53 0.26
54 0.34
55 0.35
56 0.34
57 0.34
58 0.36
59 0.34
60 0.39
61 0.32
62 0.29
63 0.27
64 0.26
65 0.29
66 0.28
67 0.34
68 0.29
69 0.32
70 0.26
71 0.27
72 0.26
73 0.22
74 0.24
75 0.21
76 0.21
77 0.16
78 0.16
79 0.16
80 0.16
81 0.17
82 0.17
83 0.13
84 0.14
85 0.15
86 0.15
87 0.18
88 0.2
89 0.2
90 0.2
91 0.2
92 0.19
93 0.18
94 0.19
95 0.17
96 0.17
97 0.17
98 0.17
99 0.18
100 0.18
101 0.18
102 0.17
103 0.19
104 0.21
105 0.22
106 0.18
107 0.24
108 0.24
109 0.24
110 0.27
111 0.31
112 0.28
113 0.28
114 0.31
115 0.25
116 0.29
117 0.29
118 0.27
119 0.22
120 0.21
121 0.21
122 0.18
123 0.18
124 0.14
125 0.14
126 0.12
127 0.11
128 0.11
129 0.17
130 0.18
131 0.18
132 0.17
133 0.19
134 0.2
135 0.26
136 0.34
137 0.33
138 0.41
139 0.5
140 0.5
141 0.54
142 0.57
143 0.52
144 0.53
145 0.55
146 0.51
147 0.44
148 0.48
149 0.47
150 0.46
151 0.46
152 0.38
153 0.35
154 0.3
155 0.29
156 0.23
157 0.2
158 0.19
159 0.2
160 0.26
161 0.23
162 0.28
163 0.34
164 0.36
165 0.37
166 0.36
167 0.39
168 0.38
169 0.42
170 0.46
171 0.47
172 0.52
173 0.59
174 0.61
175 0.58
176 0.53
177 0.55
178 0.5
179 0.5
180 0.49
181 0.49
182 0.5
183 0.5
184 0.5
185 0.43
186 0.42
187 0.44
188 0.4
189 0.38
190 0.41
191 0.51
192 0.61
193 0.71
194 0.76
195 0.77
196 0.79
197 0.79
198 0.83
199 0.76