Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J0LBD4

Protein Details
Accession J0LBD4    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
203-228CRVWTRRSGAGPRRGRRKRGGGQEASBasic
NLS Segment(s)
PositionSequence
209-223RSGAGPRRGRRKRGG
Subcellular Location(s) nucl 15.5, cyto_nucl 11.5, cyto 6.5, extr 3
Family & Domain DBs
KEGG adl:AURDEDRAFT_117809  -  
Amino Acid Sequences MPGLTAVDLEPHSALIASAFLPQEAAFAGAARDSVWYKAVIPDAIPPDPSQPLPSSQVLQAEVEDYVQHRFSWAAPPMWLTPAGRVAEQGSGSVLLSFSREEDLEYVLRNGVFLFGRALRVRRFRDSGRPRPCSNCCSLEHSARACSQAPRCGLCSGGHLTSDHRCGECDFFDDTHEGLAHCGHTSLCCPHCAGSHAMCDSACRVWTRRSGAGPRRGRRKRGGGQEASAMDLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.06
3 0.07
4 0.06
5 0.09
6 0.09
7 0.09
8 0.09
9 0.09
10 0.09
11 0.09
12 0.09
13 0.06
14 0.06
15 0.07
16 0.06
17 0.06
18 0.06
19 0.08
20 0.08
21 0.09
22 0.1
23 0.11
24 0.12
25 0.14
26 0.16
27 0.15
28 0.14
29 0.18
30 0.21
31 0.21
32 0.21
33 0.19
34 0.2
35 0.22
36 0.22
37 0.2
38 0.17
39 0.19
40 0.23
41 0.24
42 0.23
43 0.22
44 0.24
45 0.22
46 0.21
47 0.18
48 0.14
49 0.12
50 0.11
51 0.09
52 0.08
53 0.09
54 0.09
55 0.09
56 0.09
57 0.09
58 0.1
59 0.16
60 0.18
61 0.18
62 0.17
63 0.2
64 0.2
65 0.21
66 0.21
67 0.15
68 0.13
69 0.16
70 0.17
71 0.14
72 0.14
73 0.14
74 0.14
75 0.14
76 0.12
77 0.08
78 0.08
79 0.07
80 0.07
81 0.06
82 0.04
83 0.05
84 0.05
85 0.05
86 0.06
87 0.06
88 0.06
89 0.07
90 0.08
91 0.08
92 0.09
93 0.08
94 0.08
95 0.08
96 0.07
97 0.07
98 0.06
99 0.06
100 0.06
101 0.07
102 0.07
103 0.09
104 0.1
105 0.13
106 0.15
107 0.22
108 0.25
109 0.28
110 0.32
111 0.32
112 0.42
113 0.5
114 0.56
115 0.59
116 0.61
117 0.59
118 0.62
119 0.64
120 0.57
121 0.52
122 0.46
123 0.39
124 0.41
125 0.42
126 0.38
127 0.38
128 0.35
129 0.32
130 0.29
131 0.29
132 0.24
133 0.25
134 0.24
135 0.26
136 0.27
137 0.26
138 0.28
139 0.26
140 0.25
141 0.21
142 0.22
143 0.19
144 0.18
145 0.17
146 0.15
147 0.17
148 0.19
149 0.22
150 0.2
151 0.17
152 0.17
153 0.18
154 0.2
155 0.18
156 0.18
157 0.17
158 0.16
159 0.17
160 0.17
161 0.16
162 0.14
163 0.14
164 0.11
165 0.09
166 0.1
167 0.09
168 0.08
169 0.08
170 0.07
171 0.08
172 0.1
173 0.16
174 0.17
175 0.17
176 0.18
177 0.19
178 0.21
179 0.23
180 0.25
181 0.21
182 0.25
183 0.25
184 0.25
185 0.23
186 0.23
187 0.22
188 0.2
189 0.19
190 0.17
191 0.2
192 0.24
193 0.31
194 0.36
195 0.4
196 0.45
197 0.53
198 0.6
199 0.67
200 0.72
201 0.74
202 0.79
203 0.82
204 0.83
205 0.82
206 0.84
207 0.83
208 0.84
209 0.85
210 0.8
211 0.74
212 0.73
213 0.63