Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J0L9C4

Protein Details
Accession J0L9C4    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
86-107VMLSTEHRRRNYKRGNKKRVAKBasic
NLS Segment(s)
PositionSequence
93-107RRRNYKRGNKKRVAK
Subcellular Location(s) mito 21, nucl 4
Family & Domain DBs
KEGG adl:AURDEDRAFT_26265  -  
Amino Acid Sequences MNTVNASTGFSGFQLKTGRSPRLIPPLAPLADAPTPAAADAHAILKRLEDDVKEAQDNLLAAKVRQAYHANEHRGPEEVYEVGDLVMLSTEHRRRNYKRGNKKRVAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.2
3 0.27
4 0.33
5 0.36
6 0.34
7 0.38
8 0.39
9 0.46
10 0.47
11 0.4
12 0.38
13 0.4
14 0.37
15 0.34
16 0.28
17 0.21
18 0.2
19 0.2
20 0.16
21 0.1
22 0.09
23 0.09
24 0.09
25 0.05
26 0.05
27 0.05
28 0.08
29 0.08
30 0.09
31 0.09
32 0.09
33 0.1
34 0.1
35 0.11
36 0.08
37 0.11
38 0.13
39 0.14
40 0.14
41 0.14
42 0.12
43 0.12
44 0.12
45 0.08
46 0.08
47 0.07
48 0.07
49 0.1
50 0.13
51 0.12
52 0.16
53 0.18
54 0.18
55 0.27
56 0.34
57 0.37
58 0.36
59 0.38
60 0.35
61 0.35
62 0.32
63 0.25
64 0.2
65 0.14
66 0.12
67 0.11
68 0.1
69 0.08
70 0.08
71 0.07
72 0.05
73 0.05
74 0.05
75 0.06
76 0.13
77 0.19
78 0.25
79 0.31
80 0.4
81 0.46
82 0.57
83 0.67
84 0.71
85 0.77
86 0.83
87 0.88