Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G4T286

Protein Details
Accession A0A2G4T286    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
73-95VCSICKKGFKRPQDLKKHEKIHTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 10.5cyto_nucl 10.5, cyto 9.5, pero 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Pfam View protein in Pfam  
PF00096  zf-C2H2  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences MLKQTLYCQWNDCGLAFDSADELYNHLSDDHVGRKSTNNLCLQCHWNNCGTVAAKRDHLASHIRVHLPFKPHVCSICKKGFKRPQDLKKHEKIHTEEHQCNVLAIIV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.21
3 0.18
4 0.16
5 0.13
6 0.12
7 0.13
8 0.09
9 0.09
10 0.09
11 0.09
12 0.09
13 0.08
14 0.08
15 0.08
16 0.11
17 0.14
18 0.15
19 0.16
20 0.16
21 0.19
22 0.26
23 0.29
24 0.33
25 0.35
26 0.34
27 0.36
28 0.38
29 0.41
30 0.38
31 0.37
32 0.32
33 0.28
34 0.26
35 0.24
36 0.24
37 0.19
38 0.17
39 0.18
40 0.17
41 0.16
42 0.16
43 0.16
44 0.14
45 0.15
46 0.17
47 0.16
48 0.19
49 0.21
50 0.22
51 0.22
52 0.25
53 0.26
54 0.26
55 0.28
56 0.27
57 0.27
58 0.27
59 0.3
60 0.33
61 0.34
62 0.37
63 0.43
64 0.49
65 0.48
66 0.57
67 0.62
68 0.65
69 0.71
70 0.75
71 0.76
72 0.78
73 0.85
74 0.84
75 0.84
76 0.85
77 0.79
78 0.77
79 0.72
80 0.69
81 0.7
82 0.7
83 0.64
84 0.59
85 0.57
86 0.49
87 0.44