Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2G4SZB6

Protein Details
Accession A0A2G4SZB6    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
24-56TSTPNKSSKKQQSKADKTKTLKKEKEKNMAKSNHydrophilic
NLS Segment(s)
PositionSequence
36-49SKADKTKTLKKEKE
Subcellular Location(s) nucl 18, cyto_nucl 12.5, cyto 5, mito 4
Family & Domain DBs
Amino Acid Sequences MPTVNNDTSVQVVLPTPTPPTSCTSTPNKSSKKQQSKADKTKTLKKEKEKNMAKSNEQKQQLVSCEQGENEASKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.12
4 0.13
5 0.14
6 0.15
7 0.19
8 0.22
9 0.22
10 0.27
11 0.32
12 0.36
13 0.42
14 0.5
15 0.51
16 0.52
17 0.61
18 0.67
19 0.7
20 0.71
21 0.73
22 0.75
23 0.8
24 0.84
25 0.82
26 0.79
27 0.73
28 0.76
29 0.76
30 0.76
31 0.73
32 0.73
33 0.75
34 0.76
35 0.82
36 0.81
37 0.81
38 0.8
39 0.77
40 0.75
41 0.74
42 0.73
43 0.7
44 0.65
45 0.57
46 0.51
47 0.5
48 0.47
49 0.4
50 0.36
51 0.3
52 0.28
53 0.27
54 0.26
55 0.23