Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G4SKS8

Protein Details
Accession A0A2G4SKS8   
Localization Confidence Low
Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
26-49GQYITQSRYRHKPRPVSSKLSHDEHydrophilic
268-287LKGYSRRRARWVRLRKYIVTHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 12, mito 7, plas 4, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR025993  Ceramide_glucosylTrfase  
IPR029044  Nucleotide-diphossugar_trans  
Gene Ontology GO:0016020  C:membrane  
GO:0008120  F:ceramide glucosyltransferase activity  
GO:0102769  F:dihydroceramide glucosyltransferase activity  
GO:0006665  P:sphingolipid metabolic process  
Pfam View protein in Pfam  
PF13506  Glyco_transf_21  
CDD cd02520  Glucosylceramide_synthase  
Amino Acid Sequences MSLLVTILHHVLFAWYSFIVILSLYGQYITQSRYRHKPRPVSSKLSHDEAQGVTIIRPLKGIDLDLETNLRSSFTQNYPKFELLFSVASPHDPAISVVHQLMCEYPSVDCRLIVGDRQVGINPKINNMVRSYEEAKYDILWILDSNVYVDKDTLGRSVDELSRPGIGLVHHLPLAVQPKNYAAEIEHLFLDTNHAKMYLAINGVGIASCVMGKSNLYRRSDLEKAGGLVKFGKYMAEDNVIGEALWHQGLRHSMSADAACQALGELSLKGYSRRRARWVRLRKYIVTAATLVEPITESILCGLLGAFSSRALFGTSIVTFFGIHWLLWFINDYVLYVTLVEHAVANERLAIPRFLRAWLSREILALPLYLYAMAGTRISWRDQEYKCMPDGSAVPIHNNNTKVPLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.08
3 0.09
4 0.09
5 0.09
6 0.08
7 0.07
8 0.07
9 0.07
10 0.07
11 0.07
12 0.07
13 0.07
14 0.08
15 0.11
16 0.14
17 0.18
18 0.23
19 0.3
20 0.41
21 0.51
22 0.59
23 0.66
24 0.73
25 0.78
26 0.84
27 0.85
28 0.83
29 0.79
30 0.8
31 0.75
32 0.71
33 0.62
34 0.52
35 0.48
36 0.39
37 0.34
38 0.26
39 0.22
40 0.16
41 0.18
42 0.18
43 0.14
44 0.15
45 0.14
46 0.15
47 0.14
48 0.15
49 0.14
50 0.16
51 0.17
52 0.18
53 0.19
54 0.16
55 0.16
56 0.15
57 0.14
58 0.11
59 0.12
60 0.17
61 0.23
62 0.33
63 0.35
64 0.41
65 0.45
66 0.46
67 0.44
68 0.38
69 0.34
70 0.26
71 0.25
72 0.19
73 0.18
74 0.16
75 0.16
76 0.17
77 0.15
78 0.11
79 0.11
80 0.11
81 0.11
82 0.12
83 0.13
84 0.13
85 0.14
86 0.13
87 0.13
88 0.13
89 0.1
90 0.1
91 0.09
92 0.08
93 0.1
94 0.14
95 0.14
96 0.13
97 0.13
98 0.15
99 0.15
100 0.16
101 0.16
102 0.15
103 0.15
104 0.16
105 0.17
106 0.19
107 0.2
108 0.24
109 0.22
110 0.21
111 0.27
112 0.28
113 0.28
114 0.26
115 0.27
116 0.23
117 0.27
118 0.3
119 0.25
120 0.25
121 0.24
122 0.22
123 0.2
124 0.19
125 0.15
126 0.11
127 0.09
128 0.08
129 0.09
130 0.09
131 0.08
132 0.08
133 0.09
134 0.09
135 0.09
136 0.09
137 0.08
138 0.09
139 0.1
140 0.1
141 0.09
142 0.09
143 0.09
144 0.12
145 0.13
146 0.13
147 0.13
148 0.13
149 0.12
150 0.12
151 0.12
152 0.1
153 0.08
154 0.11
155 0.11
156 0.11
157 0.11
158 0.11
159 0.1
160 0.12
161 0.17
162 0.15
163 0.14
164 0.13
165 0.15
166 0.16
167 0.16
168 0.14
169 0.09
170 0.12
171 0.13
172 0.13
173 0.12
174 0.11
175 0.11
176 0.1
177 0.14
178 0.11
179 0.1
180 0.09
181 0.09
182 0.09
183 0.1
184 0.11
185 0.08
186 0.08
187 0.08
188 0.08
189 0.07
190 0.07
191 0.06
192 0.05
193 0.03
194 0.03
195 0.03
196 0.03
197 0.03
198 0.03
199 0.04
200 0.08
201 0.16
202 0.22
203 0.24
204 0.26
205 0.28
206 0.34
207 0.36
208 0.33
209 0.27
210 0.22
211 0.21
212 0.23
213 0.21
214 0.15
215 0.14
216 0.13
217 0.12
218 0.11
219 0.11
220 0.08
221 0.09
222 0.1
223 0.11
224 0.11
225 0.11
226 0.11
227 0.11
228 0.09
229 0.08
230 0.07
231 0.05
232 0.05
233 0.05
234 0.05
235 0.07
236 0.09
237 0.11
238 0.11
239 0.11
240 0.11
241 0.12
242 0.13
243 0.11
244 0.1
245 0.08
246 0.07
247 0.06
248 0.06
249 0.04
250 0.04
251 0.05
252 0.04
253 0.04
254 0.06
255 0.07
256 0.11
257 0.15
258 0.23
259 0.3
260 0.35
261 0.44
262 0.52
263 0.62
264 0.69
265 0.76
266 0.78
267 0.8
268 0.81
269 0.74
270 0.7
271 0.65
272 0.55
273 0.46
274 0.37
275 0.28
276 0.22
277 0.2
278 0.15
279 0.1
280 0.09
281 0.07
282 0.08
283 0.06
284 0.05
285 0.06
286 0.06
287 0.06
288 0.06
289 0.05
290 0.04
291 0.05
292 0.06
293 0.05
294 0.05
295 0.06
296 0.06
297 0.06
298 0.07
299 0.07
300 0.07
301 0.1
302 0.1
303 0.1
304 0.1
305 0.11
306 0.1
307 0.1
308 0.13
309 0.1
310 0.1
311 0.1
312 0.11
313 0.11
314 0.11
315 0.13
316 0.09
317 0.1
318 0.1
319 0.1
320 0.09
321 0.1
322 0.1
323 0.08
324 0.08
325 0.08
326 0.08
327 0.08
328 0.07
329 0.07
330 0.11
331 0.11
332 0.11
333 0.11
334 0.12
335 0.15
336 0.16
337 0.19
338 0.16
339 0.2
340 0.22
341 0.22
342 0.26
343 0.26
344 0.28
345 0.31
346 0.34
347 0.29
348 0.29
349 0.28
350 0.25
351 0.22
352 0.18
353 0.13
354 0.1
355 0.1
356 0.08
357 0.08
358 0.06
359 0.06
360 0.07
361 0.07
362 0.07
363 0.12
364 0.14
365 0.17
366 0.2
367 0.25
368 0.33
369 0.35
370 0.44
371 0.44
372 0.46
373 0.47
374 0.45
375 0.4
376 0.34
377 0.35
378 0.31
379 0.32
380 0.28
381 0.31
382 0.34
383 0.38
384 0.4
385 0.4
386 0.36