Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G4SSD6

Protein Details
Accession A0A2G4SSD6   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
6-29VKHNIVKKRTAHFKRHQSDRFMRVHydrophilic
NLS Segment(s)
PositionSequence
33-55WRKPKGIDNAMRRRFKGTAPMPK
Subcellular Location(s) mito 17.5, mito_nucl 11, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR018263  Ribosomal_L32e_CS  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
PROSITE View protein in PROSITE  
PS00580  RIBOSOMAL_L32E  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MVTPVVKHNIVKKRTAHFKRHQSDRFMRVGESWRKPKGIDNAMRRRFKGTAPMPKIGYGSAKKTRHLLPNGFRKFTVSNVRELNLLLMHNRTYAAEIAHNVSSKKRVAILERAAQLNVKVINAGARLRSQE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.7
3 0.71
4 0.72
5 0.79
6 0.81
7 0.85
8 0.83
9 0.81
10 0.8
11 0.76
12 0.71
13 0.61
14 0.53
15 0.45
16 0.48
17 0.48
18 0.48
19 0.48
20 0.46
21 0.46
22 0.46
23 0.5
24 0.5
25 0.51
26 0.51
27 0.54
28 0.62
29 0.69
30 0.72
31 0.67
32 0.62
33 0.54
34 0.46
35 0.46
36 0.43
37 0.45
38 0.46
39 0.49
40 0.45
41 0.44
42 0.44
43 0.34
44 0.31
45 0.23
46 0.24
47 0.29
48 0.3
49 0.3
50 0.33
51 0.37
52 0.39
53 0.42
54 0.42
55 0.41
56 0.5
57 0.53
58 0.5
59 0.45
60 0.41
61 0.37
62 0.36
63 0.38
64 0.28
65 0.3
66 0.3
67 0.31
68 0.29
69 0.28
70 0.24
71 0.15
72 0.14
73 0.1
74 0.1
75 0.1
76 0.1
77 0.1
78 0.09
79 0.09
80 0.1
81 0.1
82 0.1
83 0.11
84 0.13
85 0.15
86 0.16
87 0.15
88 0.17
89 0.2
90 0.2
91 0.2
92 0.21
93 0.23
94 0.27
95 0.35
96 0.39
97 0.42
98 0.44
99 0.44
100 0.4
101 0.38
102 0.33
103 0.29
104 0.23
105 0.17
106 0.13
107 0.12
108 0.15
109 0.16
110 0.18
111 0.16