Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G4SU29

Protein Details
Accession A0A2G4SU29   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
66-85VLWRYYHRKLPTRQRLHQLCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 10.5, cyto_nucl 7.5, mito 7, cyto 3.5, extr 3, pero 3
Family & Domain DBs
Amino Acid Sequences MPQPNFEDLLTVELPGALDFHHISLKLFRISQLLPIDVLPAHYPRGPATAWRAFWLSSFPHQAHTVLWRYYHRKLPTRQRLHQLCLNQCFQLQA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.1
3 0.09
4 0.05
5 0.07
6 0.07
7 0.08
8 0.1
9 0.1
10 0.11
11 0.13
12 0.16
13 0.16
14 0.16
15 0.15
16 0.17
17 0.17
18 0.22
19 0.21
20 0.18
21 0.17
22 0.16
23 0.16
24 0.13
25 0.14
26 0.09
27 0.08
28 0.09
29 0.09
30 0.1
31 0.1
32 0.12
33 0.11
34 0.11
35 0.17
36 0.19
37 0.19
38 0.2
39 0.2
40 0.18
41 0.18
42 0.19
43 0.15
44 0.14
45 0.19
46 0.17
47 0.19
48 0.2
49 0.21
50 0.19
51 0.22
52 0.23
53 0.2
54 0.22
55 0.26
56 0.31
57 0.35
58 0.43
59 0.45
60 0.49
61 0.58
62 0.67
63 0.72
64 0.76
65 0.78
66 0.81
67 0.8
68 0.78
69 0.75
70 0.72
71 0.69
72 0.66
73 0.61
74 0.51