Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2G4T025

Protein Details
Accession A0A2G4T025    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
41-64KVRGDKFRAEKNKKKRGSYRGGQIBasic
NLS Segment(s)
PositionSequence
45-57DKFRAEKNKKKRG
Subcellular Location(s) nucl 16, cyto_nucl 13, cyto 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR007718  Srp40_C  
Gene Ontology GO:0005730  C:nucleolus  
Pfam View protein in Pfam  
PF05022  SRP40_C  
Amino Acid Sequences QRVKPEEVEFVDERLKDNSYEAKGGSDVNSYGWKASQDLIKVRGDKFRAEKNKKKRGSYRGGQITFESHSIKF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.24
3 0.18
4 0.19
5 0.22
6 0.21
7 0.22
8 0.2
9 0.19
10 0.18
11 0.19
12 0.17
13 0.12
14 0.1
15 0.1
16 0.12
17 0.11
18 0.1
19 0.1
20 0.1
21 0.09
22 0.1
23 0.11
24 0.12
25 0.14
26 0.17
27 0.19
28 0.21
29 0.22
30 0.26
31 0.25
32 0.28
33 0.3
34 0.37
35 0.45
36 0.52
37 0.61
38 0.66
39 0.75
40 0.78
41 0.83
42 0.83
43 0.82
44 0.82
45 0.8
46 0.8
47 0.8
48 0.75
49 0.67
50 0.59
51 0.52
52 0.45
53 0.4