Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2G4SFP0

Protein Details
Accession A0A2G4SFP0    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MSKASRPLKRKISPDNKNSRRPRLNTSHydrophilic
NLS Segment(s)
PositionSequence
6-23RPLKRKISPDNKNSRRPR
Subcellular Location(s) nucl 21.5, cyto_nucl 12, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR038077  Troponin_sf  
Amino Acid Sequences MSKASRPLKRKISPDNKNSRRPRLNTSAPPRIPVRPTLASSRSSTPEPKKTVTTKRVPSWDTRGQMNQLQTKLEETGNEVDEIEKLQHDLQSSVQDQDSILQEAKQKVADLENTLHVRKAKRKSILLDCFIIGQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.86
3 0.85
4 0.88
5 0.88
6 0.87
7 0.86
8 0.81
9 0.79
10 0.77
11 0.77
12 0.77
13 0.77
14 0.77
15 0.68
16 0.67
17 0.61
18 0.57
19 0.49
20 0.43
21 0.41
22 0.34
23 0.36
24 0.38
25 0.38
26 0.36
27 0.37
28 0.36
29 0.32
30 0.31
31 0.36
32 0.36
33 0.41
34 0.42
35 0.42
36 0.44
37 0.49
38 0.55
39 0.56
40 0.58
41 0.57
42 0.58
43 0.62
44 0.58
45 0.55
46 0.53
47 0.51
48 0.44
49 0.4
50 0.36
51 0.33
52 0.34
53 0.34
54 0.3
55 0.24
56 0.22
57 0.2
58 0.2
59 0.19
60 0.16
61 0.12
62 0.11
63 0.12
64 0.12
65 0.12
66 0.11
67 0.1
68 0.1
69 0.1
70 0.08
71 0.06
72 0.06
73 0.07
74 0.08
75 0.09
76 0.1
77 0.11
78 0.15
79 0.16
80 0.16
81 0.16
82 0.15
83 0.14
84 0.15
85 0.16
86 0.13
87 0.13
88 0.13
89 0.18
90 0.19
91 0.21
92 0.19
93 0.18
94 0.17
95 0.2
96 0.2
97 0.19
98 0.2
99 0.25
100 0.27
101 0.27
102 0.29
103 0.31
104 0.35
105 0.41
106 0.48
107 0.5
108 0.55
109 0.61
110 0.66
111 0.73
112 0.75
113 0.71
114 0.64