Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2G4SUY8

Protein Details
Accession A0A2G4SUY8    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-29YYCEWKDCPRNKKPFMKRHKMHNHMRTHTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 24, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR043359  GLI-like  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Gene Ontology GO:0005634  C:nucleus  
GO:0000977  F:RNA polymerase II transcription regulatory region sequence-specific DNA binding  
GO:0006357  P:regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF00096  zf-C2H2  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences YYCEWKDCPRNKKPFMKRHKMHNHMRTHTGERPFVCTVIGCNKTFSRPDSLSTHIKTHSDSRPYLCSMPGCDKAYYHSRSLRKHIKSSHMKNSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.89
3 0.9
4 0.85
5 0.86
6 0.88
7 0.86
8 0.86
9 0.84
10 0.83
11 0.76
12 0.76
13 0.7
14 0.65
15 0.62
16 0.56
17 0.51
18 0.42
19 0.43
20 0.38
21 0.33
22 0.27
23 0.2
24 0.18
25 0.22
26 0.24
27 0.19
28 0.21
29 0.21
30 0.23
31 0.25
32 0.24
33 0.23
34 0.2
35 0.23
36 0.24
37 0.28
38 0.31
39 0.32
40 0.32
41 0.27
42 0.27
43 0.26
44 0.29
45 0.3
46 0.29
47 0.29
48 0.3
49 0.32
50 0.34
51 0.33
52 0.29
53 0.25
54 0.24
55 0.29
56 0.32
57 0.31
58 0.29
59 0.28
60 0.31
61 0.38
62 0.37
63 0.36
64 0.38
65 0.43
66 0.48
67 0.58
68 0.63
69 0.62
70 0.67
71 0.69
72 0.71
73 0.75
74 0.79